KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_0153Help
Entry
LOCK908_0153      CDS       T02731                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
lrc00473  D-Alanine metabolism
lrc00550  Peptidoglycan biosynthesis
lrc01100  Metabolic pathways
lrc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lrc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LOCK908_0153
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LOCK908_0153
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LOCK908_0153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lrc01011]
    LOCK908_0153
Enzymes [BR:lrc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LOCK908_0153
Peptidoglycan biosynthesis and degradation proteins [BR:lrc01011]
 Precursor biosynthesis
  Amino acid ligase
   LOCK908_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N GARS_A ATP-grasp_4 ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AGP72840
LinkDB All DBs
Position
complement(167639..168721)
Genome map
AA seq 360 aa AA seqDB search
MKIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDLFLGYDLEGKTVDQVFDDANT
SKDLKISDAILTDADINKLRTDGSTQLFGPNVLAICKAADIVFLALHGGDGENGKVQATL
DLNNVKYTGSGPLASGITMNKVFSKEVMLYHGIQTAAFKEFKRNQNGKHTVPFDFPVVVK
PTSGGSSVGTHIAHNQEELENGIADVFRFDNSAIVEEFTPGREFSLGVVNGRAFSAIEIK
VHSGWYDFKHKFQAGYTDFITPPKNLDESVHQAMKDVSLQTMDVLGLQNYGRIDFFANDK
GVWVIEANNLPGMTPLSLLPQEAEADGVEYGDLVMDIINGKLKLYAEGMTEAGIMTTANH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgttttagcaggcggccggagcacggaacgcaatgtgtcgatttccagc
ggctaccggatcacgaacgccttgcgacaaaaagggcaacaggccaccttcattgacctg
tttcttggctacgaccttgagggaaaaacggttgaccaagtgtttgacgatgccaacacc
agtaaggatctgaaaatttcagatgccattctgactgacgccgacatcaacaagttacgg
acagacggcagcacgcaactgtttggtcctaacgttttggcgatctgcaaggctgcagat
attgtgttcttggcactgcatggtggtgatggcgaaaatggtaaggttcaggcaacgttg
gatctgaacaacgtcaaatataccggttccggtccgctggcttccggcattaccatgaac
aaggtcttcagcaaagaagttatgttataccacggcatccagactgcggcgttcaaagaa
ttcaaacgcaatcaaaatggtaaacatacggtaccgtttgactttccggttgtcgttaag
cctacatcaggcggctctagtgttggcacgcacattgcgcacaatcaagaggaactggaa
aatggcattgcagatgttttccggttcgataacagcgcgattgtcgaagaattcacccct
ggccgcgaattttctttaggcgttgtcaatggccgggcgttttctgccattgagattaaa
gtgcattccggttggtacgacttcaagcacaaattccaagcgggctacaccgacttcatc
acgccgcctaagaatctggatgaatcagttcatcaagcaatgaaggatgtctcgttacaa
accatggacgttttgggattgcaaaactatgggcggattgacttctttgccaacgataag
ggcgtctgggtgatcgaagccaacaacctgcctggcatgacaccactttcgctcttacca
caggaagccgaagcagatggcgtagaatatggcgatctcgttatggacattatcaacggt
aaactgaaactttacgcagaaggcatgacggaagccggcattatgaccacagccaatcac
tag

DBGET integrated database retrieval system