KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_1704Help
Entry
LOCK908_1704      CDS       T02731                                 

Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Brite
KEGG Orthology (KO) [BR:lrc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lrc01001]
    LOCK908_1704
Enzymes [BR:lrc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LOCK908_1704
Protein kinases [BR:lrc01001]
 Serine/threonine kinases: Other
  Bacterial family
   LOCK908_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kdo Kinase-like Seadorna_VP7 Haspin_kinase PBP1_TM FTA2 Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: AGP74341
LinkDB All DBs
Position
complement(1668787..1670787)
Genome map
AA seq 666 aa AA seqDB search
MIEPGTILNERYKLIKTLGEGGMANVYLARDLILDRDVAVKVLRLDLQNDPDTVRRFQRE
AMATSELVHPNIVSIYDVGESHGQQFLVMEYVKGSDLKHYIVEHFPIPYQRVVDMMEQIL
SAVQTAHDHNIIHRDLKPQNILIDPDGNAKITDFGIAVALSENSMTMTNSLLGSVHYLSP
EQARGSMPTRQSDIYALGIILFEMLTGSVPFEGDSAVSIALKHFQEEIPSVRAFDPHIPQ
ALENVVFKATAKNPANRYTSADAMASDLSTALSPARAHEAKYVIPKDDLDETRIVPVIPN
GPKPPHDDDDHANQPAEHHSPDGQAKKKRRRWLMIGLSALIVMLILVGIGLVTANQKADV
TVPDLRGMTKTQAKTALTSSRLKVGKYRYTYSTKVDRDLVIDSSPKRQVSVKEGSAVDLI
LSRGQPRITLDNYVGQDYTDAKSDLQKRGVTVKEKVVRTNSVAAGKITAQSIKPGKKVIA
SKTTITFDVAEPIKKVNTAFALRDLTGYTEKSLRDYANEVGLKIVIAQSHSDTVDTGMVI
SQNPAAGTQVHAGDTVNVTISQGPDPDELKTVTKTISIPYQAPASSSTTSGSGSSSGSAS
SSGPTPNGVQVFIGDKTHNIDSVDKTFNITADNQVTITLQVNKTYPGSYRVVRDGTVVAQ
EYNITQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagccggggacgattttaaatgaacgctataagctcatcaaaacgttaggcgaa
ggcggtatggccaacgtttatttggcacgcgatctgatccttgaccgtgatgttgcggtc
aaagttttacggcttgatcttcaaaatgacccggatacggtgcgccgatttcagcgtgaa
gccatggcgacaagtgaattggtccatcccaatattgtgtcgatttatgatgtgggtgaa
agtcacggccagcagtttttggtgatggagtatgtcaaaggctctgatttgaaacactat
atcgttgaacacttcccgattccttatcaacgcgttgtcgatatgatggaacagatcttg
tcagccgttcagaccgcgcatgaccacaatattatccatcgtgatttaaaaccgcaaaat
attttgattgatccggatggtaacgccaagattaccgattttggcattgcggtagcgtta
tcggaaaattcaatgacgatgaccaactctctgttaggctctgtccattacttatcaccg
gagcaggcacgcggcagtatgcccacacggcaaagcgatatttatgcacttggtattatt
ttatttgaaatgttaaccggttcggtgccgtttgaaggcgactcggcggtttcgattgcg
ttgaaacattttcaagaagaaattccatccgtgcgcgcttttgatccccatattcctcag
gcactggagaatgttgtttttaaagccacggcgaagaatccggctaatcggtatacaagt
gccgatgccatggcaagcgatctcagcacggcactcagtcctgcccgggctcacgaagcc
aagtatgtgattccaaaagatgatttggatgagacgcgcattgtaccggtcattcccaac
ggccccaagccaccgcatgatgatgacgatcacgcaaaccaacctgctgaacaccactca
ccagatggccaggctaagaagaaacgacggcgatggttgatgatcggcctgagcgccttg
atcgtgatgttaatactggtaggaattggattggtgacggccaatcaaaaagccgatgtg
acggtacctgatttgcgcgggatgaccaagacgcaagccaaaacggcactaaccagttcg
cgattgaaggtcggaaagtatcgctatacttactcaaccaaagtcgatagggatctggtt
atagactctagtcctaagcggcaggtcagtgtcaaagaaggatcggcggttgatctgata
ctgagtcgcggacagccgcgcattaccttggataattatgtcggtcaggattatacggat
gcaaaatccgatttgcaaaaacgcggtgttaccgtcaaggaaaaagtggttcgaacaaat
tcggtcgcagccggaaaaatcacggcacaaagcattaaacccggcaaaaaagtcattgca
agtaaaaccacgattacgtttgatgttgcagagccgattaagaaagtcaatacggccttt
gcactgcgggatcttaccggttatacggaaaagagtctgcgtgactacgcaaatgaggtc
ggacttaagattgtgattgctcagagtcattccgacaccgttgataccggcatggtaatt
agccagaatccggctgctggcacgcaggttcacgcaggcgatacggtcaatgtgacgatt
tctcaaggcccggatcctgatgaactcaaaaccgttaccaaaaccatttcaattccttat
caggcgccagcatcatctagcacaaccagtggcagcggaagcagtagtggcagtgctagc
agcagtggaccgacgccaaacggggttcaggtgttcatcggcgataagacacataacatt
gactcggttgacaagacgtttaatattaccgcggataatcaggtcaccattaccttgcaa
gtcaacaagacgtatccgggtagttatcgggtggtacgagatggcaccgttgtcgcacag
gagtacaatattacacaatga

DBGET integrated database retrieval system