KEGG   Lactobacillus reuteri DSM 20016: Lreu_0291Help
Entry
Lreu_0291         CDS       T00535                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00010  Glycolysis / Gluconeogenesis
lre00260  Glycine, serine and threonine metabolism
lre00680  Methane metabolism
lre01100  Metabolic pathways
lre01110  Biosynthesis of secondary metabolites
lre01120  Microbial metabolism in diverse environments
lre01130  Biosynthesis of antibiotics
lre01200  Carbon metabolism
lre01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lreu_0291
  09102 Energy metabolism
   00680 Methane metabolism
    Lreu_0291
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lreu_0291
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lre04131]
    Lreu_0291
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lre04147]
    Lreu_0291
Enzymes [BR:lre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Lreu_0291
Membrane trafficking [BR:lre04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Lreu_0291
Exosome [BR:lre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Lreu_0291
  Exosomal proteins of melanoma cells
   Lreu_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABQ82561
UniProt: A5VI87
LinkDB All DBs
Position
340329..341039
Genome map
AA seq 236 aa AA seqDB search
MAELVIVRHGQSQANRDNIFTGWTDVPLTPKGIEQGELVGKELLRLGIQFSDAYTSYMER
AIMTTNIILEEINQLYIPVHKTWRLNERHYGALSGRNKDEVKKEIGAEQLHKWRRGFKDL
PPQLKERQHDRRYDRLGVKIPLSESLEMTLQRLLPYWQDHIAPRLIDGHNQLIVAHGSSL
RALIKYLDGISDDDIDKVEVPNGKPILYRFDDHLNVIKKTFITMDGEIDDNTRISK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattagtaattgtacgtcatgggcaaagtcaagctaaccgtgataatattttt
actggctggactgatgttccgttgactcctaaaggaattgaacaaggtgaattagtcggc
aaggaattgctaagactaggtatccaatttagtgatgcgtatacgtcctacatggaacgg
gcaatcatgacaactaatattatcctagaagaaattaatcagttatatattccggttcat
aaaacgtggcgactaaacgaacgtcattatggagcattgagtggtcggaacaaagatgaa
gtgaagaaagagattggtgcagaacagcttcataaatggcggcgtggttttaaagattta
ccaccacaattaaaagagcgtcagcatgatcgccgctatgatcgcttaggagttaagatt
ccgcttagtgagagtttagaaatgacgctccaacgactcctcccatattggcaagaccat
attgcgcctcgtttaattgacggacacaatcagttaattgttgcccatggtagttctttg
cgggcactaattaaatatttagatggtatttcagatgacgatattgataaagtggaagtt
ccaaatggcaagccaattttatatcgctttgatgatcatcttaatgtcattaaaaagact
tttataacaatggatggtgaaattgatgacaatacacgaattagcaaataa

DBGET integrated database retrieval system