KEGG   Lactobacillus reuteri DSM 20016: Lreu_0477Help
Entry
Lreu_0477         CDS       T00535                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00473  D-Alanine metabolism
lre00550  Peptidoglycan biosynthesis
lre01100  Metabolic pathways
lre01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Lreu_0477
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lreu_0477
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Lreu_0477
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lre01011]
    Lreu_0477
Enzymes [BR:lre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Lreu_0477
Peptidoglycan biosynthesis and degradation proteins [BR:lre01011]
 Precursor biosynthesis
  Amino acid ligase
   Lreu_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABQ82745
UniProt: A5VIS1
LinkDB All DBs
Position
530114..531250
Genome map
AA seq 378 aa AA seqDB search
MTQKLHIALLFGGNSSEHDVSKRSAHNIYDALDKEKYDVSLFMFTKDGILLGNEDSQKIF
DGEPEDQVVAEAYQKMDMSSPLAPIMALNEQKEIDFFFPVIHGNLGEDGTIQGLFKLLNK
PYVGSNIAASAMSFDKDLTKKIISQAGIRNTPYVVVTPENQADYSWGRIEEKLGNLTFVK
PAKQGSSVGIHRVTNAEEYEKALDDAFKYDYKILVEQGIANPQEIEISILGNEHPIASKL
GAVRVPKDDPFYDYENKFVDASGVVFELPVKLPQYLVDEITDMALKAYKALGMKGMARID
FLVDSNNVPYLGEPNTLPGFTNISLYPQMWEVSGISYSDLIDRLIQLGLQEFERNSKIKY
DFRKLGTERVGQKKYNED
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaattacacatcgctttattatttggtggcaactcctctgaacatgatgtg
tcaaagcgatcagcacataatatctatgatgctcttgataaggaaaagtatgatgtaagt
ctttttatgtttacaaaggatggaattctattaggcaatgaggattcccaaaagatcttt
gatggcgaacctgaagaccaagtggtagcggaagcatatcaaaagatggatatgagtagt
ccattagcaccaattatggccttaaacgaacaaaaggaaattgatttcttcttccctgtt
atccatggtaatttaggtgaagatggtacaattcaaggtctctttaagctccttaataag
ccatacgttggttcaaatattgcagctagtgcgatgtcttttgacaaggaccttactaag
aagattattagtcaagctggtattcgcaacaccccttatgtagtagttacgccagaaaac
caggctgactattcatggggacggattgaagaaaaattaggcaatctcacttttgtaaag
ccagctaagcaaggttcctccgttggaattcatcgagttactaacgctgaagaatacgaa
aaagcattagacgatgcctttaagtatgactacaagatcttagtagaacaaggaatcgct
aatcctcaagaaattgagatttcaatcttaggaaatgaacacccaattgcctctaagtta
ggagctgtacgtgtacctaaggatgatccattctatgattatgaaaacaaatttgtggat
gccagtggagttgtttttgaacttcctgttaaattaccacaatacttagttgatgaaatt
acagacatggctttgaaggcatacaaggcattaggaatgaaggggatggctcggattgac
tttttagttgacagcaataatgtcccttatcttggtgaaccaaatactttaccaggattt
actaacattagtttgtatcctcaaatgtgggaagtttctgggatttcatattccgacttg
attgatcggctaattcaattaggattacaagaatttgaacgaaacagtaagattaagtac
gatttccgtaagcttggtaccgaacgtgttggtcaaaagaaatataacgaagactaa

DBGET integrated database retrieval system