KEGG   Lactobacillus reuteri DSM 20016: Lreu_1211
Entry
Lreu_1211         CDS       T00535                                 

Definition
(GenBank) cell elongation-specific peptidoglycan D,D-transpeptidase
  KO
K21465  penicillin-binding protein A
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lreu_1211
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lre01011]
    Lreu_1211
Peptidoglycan biosynthesis and degradation proteins [BR:lre01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Lreu_1211
SSDB
Motif
Pfam: Transpeptidase PBP_dimer Ribonuclease_3
Other DBs
NCBI-ProteinID: ABQ83468
UniProt: A5VKU4
LinkDB
Position
complement(1258933..1261011)
AA seq 692 aa
MKFFDRIMNLFGSRTKKRQNAQSIIPFRLNMLLWIVGILLLALTIRLFYLQVLQGTSFKA
EVKRSDTTTQTNNVQRGMIYDSQGNVLVGNQTHQAITYTKGANVTTDQLYQIANRLGKYV
SVSNKNSRLTDRNEEDYYLADKERLKSVLKHVKTSDADSEDTKYDKALEYLSKHPDSWEL
TDQQKNNARIYAAMSGAYSLSTTYIKETGVSAKELAAVGEHLNEMPGVKIGTSWTRNYPQ
GTDIQSLTGTVSTTGLPSDEVNSLLAQGYSRNDSVGQSYLEKQFQSTLAGSKSQTEVTTD
GNDVTKEKTKYPGKKGDNLVLTINSKFQKQVQSILKNNYSAAGNQYSTGVYAVVMNPNTG
AIYAMAGIDRNPETGKETPDEIGAINHPITMGSVVKPAMVMGALMDGVITPTNNTLTDMP
IKLAGTSSKGSWFNHGGSANMAINAATALEVSSNSYMMQLLMKEAGMKYTPNAQITMKPS
IFAKARGYFNMFGLGVKTGIDLPGETSGYTGPADQKHIGSALDLSYGNYDGYTLIQLAQY
MSTIANGGNRMRPYIVKEIRGTKANGQLGAVEYTTKPQVQLTIPASKADFDVVKQGLYQV
VHGSNRYVTGKPLASVKPSVSGKTGTAETYYKSHSTTTLSFAGFAPSDNPQVVVALAIPG
ASNSDGGANLTMAKQIFEAYWKTVQSPKGFGD
NT seq 2079 nt   +upstreamnt  +downstreamnt
gtgaaattctttgatcgaataatgaacttatttggttcacgtaccaaaaagcgtcaaaat
gcgcagtcaattattccattccggctgaacatgctactatggattgttggtatcttgtta
ttagcgttaactattcgactgttttatcttcaagttctgcaaggaacatcatttaaagcg
gaagtaaagcgatcagatacaacaacgcagacgaataacgtacaacgggggatgatttat
gattcacaagggaacgttcttgttggtaatcaaactcatcaagccattacctataccaaa
ggggccaatgtaactactgatcagctctatcagattgctaatcgtttaggaaaatatgtg
tctgtctctaataagaattcacgcttaactgatcgaaatgaagaggattattaccttgct
gataaagagcggcttaagagtgttttgaaacatgtcaagacttcagatgccgattctgaa
gatactaaatatgataaagctctcgaatatttgagcaagcatcctgattcatgggagctt
actgatcagcaaaagaataatgcccgaatttatgcggcaatgagtggagcatattccctt
tcgacaacttatattaaagaaacaggtgttagtgctaaagagcttgcagcagttggagaa
cacctgaatgaaatgccaggggtaaagatcggcacgtcttggactcgtaattacccacaa
ggcacagatattcaatcgttaacaggaactgtctcaactactggtttaccaagtgatgaa
gttaactcactgcttgctcaaggatattctcgaaatgatagcgttggacaaagttatctt
gaaaagcagttccaatcaaccttagccgggtcgaagtcacaaactgaggttactactgat
ggaaatgacgtaactaaagaaaagactaagtaccctggtaagaagggtgataaccttgta
ttgacgattaattcaaagttccaaaagcaagttcaatcgattttgaaaaacaattactcg
gctgccggaaaccagtactctactggggtatatgcagtagtaatgaatccaaataccggt
gcaatttatgcgatggctggtattgatcgtaacccagaaacaggtaaagaaacccctgat
gaaattggtgctatcaaccacccaattacgatgggttccgttgtaaagccggcgatggtc
atgggggcattaatggatggtgtaattacgccaacaaataataccttaaccgatatgcca
attaagcttgctggaacttcatctaagggatcatggtttaaccatggcggctcagcaaat
atggcaattaatgcagcaacggccctcgaagtttcttccaactcttatatgatgcaacta
ctcatgaaagaagcaggaatgaaatatacaccgaatgcgcaaattacgatgaagccaagt
atttttgctaaagcgcggggttacttcaacatgtttggactcggagttaaaactggaatc
gacttgcctggtgaaacaagcggttatacaggacctgctgaccaaaagcatatcggttca
gcacttgacttgtcatatggtaactatgatggttatactttgattcaacttgcccaatat
atgtctaccattgctaacggtggtaaccggatgcgtccatacattgttaaagaaatccgt
ggtacgaaagccaatggtcaacttggtgccgttgaatatacaacaaagccccaagttcaa
ttaaccattcctgcttctaaagctgactttgatgtcgttaaacaagggctttatcaagtg
gttcatggttctaaccgttatgttactggtaaaccgttggcatctgttaaaccatcagta
tctggtaagacagggactgccgaaacctactacaagtcgcactcaacaactacgctaagt
tttgccggatttgcgccatctgataatccacaagttgtagttgctttggctattccagga
gcttcaaattccgatggtggtgccaacctgacaatggcaaaacaaatttttgaggcctac
tggaagactgttcagagtcccaagggttttggtgactaa

DBGET integrated database retrieval system