KEGG   Lactobacillus reuteri JCM 1112: LAR_0465Help
Entry
LAR_0465          CDS       T00735                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00473  D-Alanine metabolism
lrf00550  Peptidoglycan biosynthesis
lrf01100  Metabolic pathways
lrf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lrf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LAR_0465
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LAR_0465
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LAR_0465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lrf01011]
    LAR_0465
Enzymes [BR:lrf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LAR_0465
Peptidoglycan biosynthesis and degradation proteins [BR:lrf01011]
 Precursor biosynthesis
  Amino acid ligase
   LAR_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAG24981
LinkDB All DBs
Position
538404..539552
Genome map
AA seq 382 aa AA seqDB search
MVFIMTQKLHIALLFGGNSSEHDVSKRSAHNIYDALDKEKYDVSLFMFTKDGILLGNEDS
QKIFDGEPEDQVVAEAYQKMDMSSPLAPIMALNEQKEIDFFFPVIHGNLGEDGTIQGLFK
LLNKPYVGSNIAASAMSFDKDLTKKIISQAGIRNTPYVVVTPENQADYSWGRIEEKLGNL
TFVKPAKQGSSVGIHRVTNAEEYEKALDDAFKYDYKILVEQGIANPQEIEISILGNEHPI
ASKLGAVRVPKDDPFYDYENKFVDASGVVFELPVKLPQYLVDEITDMALKAYKALGMKGM
ARIDFLVDSNNVPYLGEPNTLPGFTNISLYPQMWEVSGISYSDLIDRLIQLGLQEFERNS
KIKYDFRKLGTERVGQKKYNED
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtggtatttattatgacccaaaaattacacatcgctttattatttggtggcaactcctct
gaacatgatgtgtcaaagcgatcagcacataatatctatgatgctcttgataaggaaaag
tatgatgtaagtctttttatgtttacaaaggatggaattctattaggcaatgaggattcc
caaaagatctttgatggcgaacctgaagaccaagtggtagcggaagcatatcaaaagatg
gatatgagtagtccattagcaccaattatggccttaaacgaacaaaaggaaattgatttc
ttcttccctgttatccatggtaatttaggtgaagatggtacaattcaaggtctctttaag
ctccttaataagccatacgttggttcaaatattgcagctagtgcgatgtcttttgacaag
gaccttactaagaagattattagtcaagctggtattcgcaacaccccttatgtagtagtt
acgccagaaaaccaggctgactattcatggggacggattgaagaaaaattaggcaatctc
acttttgtaaagccagctaagcaaggttcctccgttggaattcatcgagttactaacgct
gaagaatacgaaaaagcattagacgatgcctttaagtatgactacaagatcttagtagaa
caaggaatcgctaatcctcaagaaattgagatttcaatcttaggaaatgaacacccaatt
gcctctaagttaggagctgtacgtgtacctaaggatgatccattctatgattatgaaaac
aaatttgtggatgccagtggagttgtttttgaacttcctgttaaattaccacaatactta
gttgatgaaattacagacatggctttgaaggcatacaaggcattaggaatgaaggggatg
gctcggattgactttttagttgacagcaataatgtcccttatcttggtgaaccaaatact
ttaccaggatttactaacattagtttgtatcctcaaatgtgggaagtttctgggatttca
tattccgacttgattgatcggctaattcaattaggattacaagaatttgaacgaaacagt
aagattaagtacgatttccgtaagcttggtaccgaacgtgttggtcaaaagaaatataac
gaagactaa

DBGET integrated database retrieval system