KEGG   Lactobacillus reuteri JCM 1112: LAR_1352Help
Entry
LAR_1352          CDS       T00735                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00970  Aminoacyl-tRNA biosynthesis
lrf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LAR_1352
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lrf03029]
    LAR_1352
Enzymes [BR:lrf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LAR_1352
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LAR_1352
Mitochondrial biogenesis [BR:lrf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LAR_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAG25868
UniProt: B2G8T6
LinkDB All DBs
Position
complement(1539957..1541429)
Genome map
AA seq 490 aa AA seqDB search
MDFYQTSLSQLHDDLVNKKISATELTKETFDHIKGNEDQVKAFISLNEDQALKRAAEIDA
KGISADQLTAGVPLAVKDNILTKGLTTTAASKMLENFNPVYDATVVEKLNAADYINVGKT
NLDEFAMGSSTENSAFFTTHNPWDLTRVPGGSSGGSAAAVAAGDVLGALGTDTGGSIRMP
ASFNGVVGMKPTYGRVSRWGIIAFGSSFDQVGWLTQNVKDNALLTALISGNDERDMTSSL
KEVPDWAAQLNENTNVKGLRIAVPKEYFDGLDEDVQEVIKAALDHLESLGAIVDEVSLPH
TKYGVPAYYILASSEASSNLQRYDGIRYGFRAADVKNLEDVYVRSRSEGFGEEVKRRIML
GTFSLSAGFYDAYFNKAAKVRRLIAQDFEDVFKDHDVIVGATGASTAFKIGAEIDDPQTM
YMNDVLTVPVNMAGLPAMSIPAGFSAKNGMPVGLQIIGKAFDEQTVYNTGYVFEQTTDFH
KKTPKLGGQN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatttttaccaaacaagcttgagtcaattgcacgatgacttggtaaataagaaaatt
agtgcaactgaattaaccaaggaaacttttgaccacattaagggtaacgaagatcaagtt
aaagccttcatcagcttaaatgaggaccaagcactaaagcgggcagctgagattgatgca
aaaggtattagtgctgatcaattaactgcaggggttccgcttgcagttaaggataatatt
ttaactaagggccttacaacgacggctgcttctaagatgcttgaaaactttaaccccgta
tatgacgcgacagttgttgaaaagttaaatgccgctgattacatcaatgttggtaagact
aaccttgatgaatttgccatgggatcatctactgaaaattcagcattctttacgactcat
aacccatgggatcttacacgggttcctggtggttcttccggtggttctgctgctgctgtt
gcggccggagatgttttaggtgcgcttggtactgatactggtggttctattcggatgcct
gcttcctttaacggtgtcgttgggatgaagcctacatacggtcgtgtatcgcggtgggga
atcattgcctttggttcaagttttgaccaagtcggctggttgacccaaaatgttaaggat
aatgccttgttgaccgccctcatcagtggaaatgatgaacgggatatgacatcctcactt
aaagaagttccagactgggcagcccaattaaacgaaaatacgaatgttaaaggcttacgg
attgctgtgccaaaggaatactttgatggcttagacgaagatgttcaagaagtaatcaag
gctgctttggaccacttagaatccctcggcgcaattgttgatgaagtaagtttgccacac
accaagtatggggttcctgcttactacattttagcctcatctgaagcatcttctaacctc
caacgttacgatggtatccgttatggcttccgagctgctgatgttaagaacttggaagac
gtttatgttcgttctcgttcggaaggtttcggtgaagaagttaagcggcggattatgtta
gggacattctctctatctgctggtttctatgatgcctactttaataaggccgctaaagtt
cgtcgtcttattgcccaagattttgaagacgtatttaaggatcatgatgtaatcgttggt
gctactggtgcttcaacggcatttaagattggtgcggagattgacgatccacaaactatg
tacatgaacgatgtattgactgttcccgttaatatggccggtcttcctgcaatgtccatt
cctgctggcttctctgctaaaaatggcatgccagttggtctgcaaatcatcggaaaagca
tttgacgaacaaacagtttataacactggatatgtctttgaacagacaactgatttccat
aagaagacaccaaagttaggaggtcaaaattaa

DBGET integrated database retrieval system