KEGG   Lactobacillus rhamnosus GG: LRHM_0915Help
Entry
LRHM_0915         CDS       T02100                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lrg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LRHM_0915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lrg03400]
    LRHM_0915
Enzymes [BR:lrg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     LRHM_0915
DNA repair and recombination proteins [BR:lrg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LRHM_0915
 Prokaryotic type
     LRHM_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAI41442
LinkDB All DBs
Position
965372..966061
Genome map
AA seq 229 aa AA seqDB search
MKTLIHNDWQTVLEPIFESSEYARLHGFLKEEYATKTIYPEMHHIFQAFEWTPFHDVKVV
ILGQDPYHNPHQAVGASFAVAPGVALPPSLQNIYKELQSDLGYPPVHHGYLKAWANQGVL
LLNAVLTVQAGHAYSHQNHGWEALTDAAIAALSARGGVVFILWGNAAKKKAALIDTSKNA
IIASAHPSPLSASRGFFGSRPFSRTNEALEKMGETPINWQLPETVTTEN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacattaatccataatgattggcagacggttctggaaccgatttttgaaagttcc
gaatatgcacggctgcatggctttttaaaagaagagtatgccactaaaacgatctatccc
gagatgcatcatatcttccaggccttcgaatggaccccgtttcatgatgttaaagtggtg
attttaggccaggatccttaccacaatccgcatcaggcagtgggggctagttttgcggtt
gcgcctggcgttgccttgccaccatcactgcagaatatttataaagaattgcaaagcgac
ttagggtatccacctgtgcaccacggctatcttaaagcgtgggcgaatcaaggcgtttta
ttgctcaatgcggtcctgaccgtgcaggctggacacgcgtattcgcatcagaatcacggc
tgggaagcattaaccgatgccgcgattgccgctttgtcagcgcgcggtggcgtcgtgttc
attttatggggcaatgcggccaagaaaaaagccgccttgattgacacttctaaaaatgcc
atcattgcgtccgcacatccaagtcctttatcagcatcacgtggtttttttggtagtcgg
ccgttttctcgcacgaatgaggcattagagaaaatgggagagacgccgattaattggcag
ctgccagagacggttacgacagaaaattaa

DBGET integrated database retrieval system