KEGG   Lactobacillus rhamnosus GG: LGG_01667Help
Entry
LGG_01667         CDS       T00987                                 

Gene name
stkP
Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lrh  Lactobacillus rhamnosus GG
Brite
KEGG Orthology (KO) [BR:lrh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lrh01001]
    LGG_01667 (stkP)
Enzymes [BR:lrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LGG_01667 (stkP)
Protein kinases [BR:lrh01001]
 Serine/threonine kinases: Other
  Bacterial family
   LGG_01667 (stkP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kdo Kinase-like Seadorna_VP7 Haspin_kinase PBP1_TM FTA2 Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: CAR87562
LinkDB All DBs
Position
complement(1691971..1693971)
Genome map
AA seq 666 aa AA seqDB search
MIEPGTILNERYKLIKTLGEGGMANVYLARDLILDRDVAVKVLRLDLQNDPDTVRRFQRE
AMATSELVHPNIVSIYDVGESHGQQFLVMEYVKGSDLKHYIVEHFPIPYQRVVDMMEQIL
SAVQTAHDHNIIHRDLKPQNILIDPDGNAKITDFGIAVALSENSMTMTNSLLGSVHYLSP
EQARGSMPTRQSDIYALGIILFEMLTGSVPFEGDSAVSIALKHFQEEIPSVRAFDPHIPQ
ALENVVFKATAKNPANRYTSADAMASDLSTALSPARAHEAKYVIPKDDLDETRIVPVIPN
GPKPPHDDDDHADQPAEHHSPDGQAKKKRRRWLMIGLSALIVMLILVGIGLVTANQKADV
TVPDLRGMTKTQAKTALTSSRLKVGKYRYTYSTKVDRDLVIDSSPKRQVSVKEGSAVDLI
LSRGQPRITLDNYVGQDYTDAKSDLQKRGVTVKEKVVRTNSVAAGKITAQSIKPGKKVIA
SKTTITFDVAEPIKKVNTAFALRDLTGYTEKSLRDYANEVGLKIVIAQSHSDTVDTGMVI
SQNPAAGTQVHAGDTVNVTISQGPDPDELKTVTKTISIPYQAPASSSTSSDSGSSSGSAS
SSGPTPNGVQVFIGDKTHNINSVNKTFNITADNQVTITLQVNKTYPGSYRVVRDGTVVAQ
EYNITQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagccggggacgattttaaatgaacgctataagctcatcaaaacgttaggcgaa
ggcggtatggccaacgtttatttggcacgcgatctgatccttgaccgtgatgttgcggtc
aaagttttacggctcgatcttcaaaatgacccggatacggtgcgccgatttcagcgtgaa
gccatggcgacaagtgaattggtccatcccaatattgtgtcgatttatgatgtgggtgaa
agtcacggccaacagtttttggtgatggagtatgtcaaaggctctgatttgaaacactat
atcgttgaacacttcccgattccttatcaacgcgttgtcgatatgatggaacagatcttg
tcagccgttcagaccgcgcatgaccacaatattatccatcgtgatttaaaaccgcaaaat
attttgattgatccggatggcaacgccaagattaccgattttggcattgcggtagcgtta
tcggaaaattcaatgacgatgaccaactctctgttaggctctgtccattacttatcaccg
gagcaggcacgcggcagtatgcccacacggcaaagcgatatttatgcacttggtattatt
ttatttgaaatgttaaccggttcggtgccgtttgaaggcgactcggcggtttcgattgcg
ttgaaacattttcaagaagaaattccatccgtgcgcgcctttgatccccatattcctcag
gcactagagaatgttgtttttaaagccacggcgaagaatccggctaatcggtatacaagt
gccgacgccatggcaagcgatctcagcacggcgctcagtcctgcccgggctcacgaagcc
aagtatgtgattccaaaagatgatttggatgagacgcgcattgtaccggtcattcccaac
ggccccaagccaccgcatgatgatgacgatcacgcagaccaacctgctgaacaccattca
ccagatggccaggctaagaagaaacgacggcgatggttgatgatcggcctgagcgccttg
atcgtgatgttaatactggtaggaattggattggtgacggccaatcaaaaagccgatgtg
acggtccctgatttgcgcgggatgaccaagacgcaagctaaaacggcactaaccagttcg
cgattgaaggtcggaaagtatcgctatacttactcaaccaaagtcgatagggatctggtt
atagactctagtcctaagcggcaggtcagtgtcaaagaaggctcggcggttgatctgata
ctgagtcgcggacagccgcgcattaccttggataattatgtcggtcaggattatacggat
gcaaaatccgatttgcaaaaacgcggtgttaccgtcaaggaaaaagtggtccgaacaaat
tcggtcgcagccggaaaaatcacggcacaaagcattaaacccggcaaaaaagtcattgca
agtaaaaccacgattacgtttgatgttgcagagccgattaagaaagtcaatacggccttt
gcactgcgggatcttaccggttatacggaaaagagtctgcgtgactacgcaaatgaggtc
ggacttaagattgtgattgctcagagtcattccgacaccgttgataccggtatggtaatt
agccagaatccggctgctggcacgcaggttcacgcaggcgatacggtcaatgtgacgatt
tctcaaggtccggatcccgatgaactcaaaaccgttaccaaaaccatttcaatcccttat
caggcgccggcatcttcaagcacatccagcgacagcggaagcagtagtggcagtgctagc
agcagtggaccgacgccaaacggggttcaggtgttcatcggcgataagacacataacatt
aattcggttaacaagacgtttaatattaccgcggataatcaggtcaccattaccttgcaa
gtcaacaagacgtatccgggtagttatcgggtggtacgagatggcaccgttgtcgcacag
gagtacaatattacacaatga

DBGET integrated database retrieval system