KEGG   Leminorella richardii: NCTC12151_00267Help
Entry
NCTC12151_00267   CDS       T05503                                 

Gene name
aroK
Definition
(GenBank) Shikimate kinase 1
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
lri  Leminorella richardii
Pathway
lri00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lri01100  Metabolic pathways
lri01110  Biosynthesis of secondary metabolites
lri01130  Biosynthesis of antibiotics
lri01230  Biosynthesis of amino acids
Module
lri_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCTC12151_00267 (aroK)
Enzymes [BR:lri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NCTC12151_00267 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin AAA_18 dNK Cytidylate_kin2 AAA TsaE AAA_22 AAA_16 His_biosynth AAA_5 ABC_tran AAA_17 Ploopntkinase3 AAA_28 APS_kinase AAA_7 AAA_24 RsgA_GTPase AAA_PrkA RNA_helicase ATPase_2 AAA_29 AAA_25 IstB_IS21 CoaE Mg_chelatase AAA_14 AAA_2 GTP_EFTU MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: SQI34867
UniProt: A0A2X4U4V5
LinkDB All DBs
Position
1:292596..293114
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRQLAQQLNMEFVDSDHEIERRTGADIAWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSKETRNRLSARGIVVYLETNIEKQLARTQRDKKR
PLLQVDTPRDVLETLAKERNPLYEEIADVTIHTDDQSAKVVANQIIQLIENR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctgattggtccaatgggggctggaaaaagcactatt
ggccgtcagctggctcaacagcttaatatggagtttgtggactccgatcacgagattgaa
cgccgtactggagctgatatagcctgggtattcgatgtggaaggcgaagaagggtttcgc
gatcgtgaagaaaaagtgattaacgaactgaccgaaaagcagggcatcgtgcttgcgacc
ggcggtggctctgtgaagtccaaagagacccgcaatcgtctgtctgcccgcggtatcgtt
gtctatcttgaaaccaacattgaaaagcagctggcccgcacccagcgcgataagaagcgt
ccgctgcttcaggttgatacgcctagagacgtgctggaaactctggcaaaagagcgcaat
cctctttatgaagagattgccgatgtcacgattcataccgacgatcaaagcgcaaaggtt
gttgcaaaccaaatcattcagcttattgagaatcgctga

DBGET integrated database retrieval system