KEGG   Leminorella richardii: NCTC12151_01161Help
Entry
NCTC12151_01161   CDS       T05503                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase 1
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
lri  Leminorella richardii
Pathway
lri00061  Fatty acid biosynthesis
lri00780  Biotin metabolism
lri01100  Metabolic pathways
lri01212  Fatty acid metabolism
Module
lri_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC12151_01161 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC12151_01161 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lri01004]
    NCTC12151_01161 (fabB)
Enzymes [BR:lri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     NCTC12151_01161 (fabB)
Lipid biosynthesis proteins [BR:lri01004]
 Fatty acid synthase
  Component type
   NCTC12151_01161 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: SQI38438
UniProt: A0A2X4URY5
LinkDB All DBs
Position
1:1182940..1184151
Genome map
AA seq 403 aa AA seqDB search
MKRAVITGLGVISSIGNNKEEVLASLELGRSGITHAQELQDAGMRSHVWGNVKLDTAGLI
DRKIARFMSDASVYAYLSMQEAIKDSGLADEDVSNERTGLVVGSGGGSPRSQVAGADGMR
ARGIRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGHAVELIQLGKQ
DVVFAGGGEEMCWELACEFDAMGALSTKYNEMPEKASRTYDSERDGFVISGGGGMVVVEE
LEHALARGAHIYGEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNVHGTST
PVGDVKELGAIREVFGNNTPAISSTKAMTGHALGAAGVHEAIYSLLMLEHGFIAPSINIE
QLDPEAEGMNIVTKTTRQALTTVMSNSFGFGGTNATLVMRKYR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcagttatcaccggtttaggtgttatatcgagtattggtaataataaagag
gaagttctggcatctctggagctggggcgttccggtattactcatgctcaggaactgcaa
gacgcaggtatgcgcagtcacgtctggggaaatgtaaaactggatacggcaggactgatc
gaccggaaaatcgcccgctttatgagcgatgcttccgtgtatgcctacctttctatgcag
gaagcgattaaagactcaggcctggcggatgaagatgtatctaacgagcgcacggggctg
gttgttggttctggcggcggctctccgcgcagtcaggttgctggtgcagacggcatgcgc
gcgcgcggtatccgcggcgtgggtccgtacatggtaaccaaggcgatggcttcaggggtt
tctgcctgcctcgccacgccgtttaaaattcgcggcgttaactattccatcagttctgcg
tgtgcaacgtcggctcactgtattggccacgccgttgagctgattcagcttggtaagcag
gacgttgtgttcgctggcggcggtgaagagatgtgctgggaactggcatgtgagtttgac
gccatgggcgcgttgtccaccaagtacaatgaaatgcctgaaaaggcttctcgtacctat
gattcagagcgcgacggttttgttatctccggcggcggcggcatggttgtcgttgaagag
ctggaacacgcgctggcgcgcggtgcccatatctatggcgaaatcgttggctacggcgca
acgtctgacggtgccgacatggtcgctccatccggtgaaggtgcagtgcgctgcatgaag
atggcgatgcacggtgttgatacaccgattgactatctgaacgttcacggcacctctacg
ccggttggcgacgtgaaagagcttggtgcgattcgtgaagtgtttggtaacaatacgcct
gccatttcatcgactaaagcaatgaccggccacgcgctgggtgctgcgggcgttcatgaa
gccatttactcgctgctgatgctggaacacggctttattgctcctagcattaatattgag
cagctggatccggaagcagaaggcatgaacatcgtaaccaagacgacgcgtcaggctctg
acgacagtcatgtctaacagctttggcttcggcggtactaacgcaacgctagtgatgcgt
aaatatcgttaa

DBGET integrated database retrieval system