KEGG   Leminorella richardii: NCTC12151_01708Help
Entry
NCTC12151_01708   CDS       T05503                                 

Gene name
alr_2
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
lri  Leminorella richardii
Pathway
lri00473  D-Alanine metabolism
lri01100  Metabolic pathways
lri01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lri00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCTC12151_01708 (alr_2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NCTC12151_01708 (alr_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lri01011]
    NCTC12151_01708 (alr_2)
Enzymes [BR:lri01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NCTC12151_01708 (alr_2)
Peptidoglycan biosynthesis and degradation proteins [BR:lri01011]
 Precursor biosynthesis
  Racemase
   NCTC12151_01708 (alr_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Orn_Arg_deC_N
Motif
Other DBs
NCBI-ProteinID: SQI40733
UniProt: A0A2X4UPI2
LinkDB All DBs
Position
1:1789489..1790703
Genome map
AA seq 404 aa AA seqDB search
MTFRFRHLLLVPLFTLAACSQTEYSTQSNAGQQQAVVNNAWLEISQSALDFNTKKVQALL
NGKSTLCAILKGDAYGHDLALVAPVIMKNNVQCIGVASNQELKTVRELGFQGRLMRVRNA
TEQEMRQAIDYDVEELIGSLDMAKRLDALAAGREKALRIHLALNSGGMSRNGLEVSRDAG
LEEAKAISALKHLKVVGIMSHYPEEDVAKVKSDLARFQKQAARVLEVTGIPREQVKLHVA
NTFATLTVPDSWLDMVRVGGVFYGDTIASTEYQRVMTFKSNIASLNRYPKGNTVGYDRTY
TLKRDSLLANIPLGYSDGYRRVFSNAGHVLIQGQRLPVLGKTSMNTIVVDVTDLKNVTSG
EEVVLFGKQGKAEIKAEEIEDISGALFTEMSILWGATNPRILVD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacatttcgttttcgccacctgctgttggtgccgctttttactctggctgcctgtagc
cagaccgagtattcgacgcagtcaaacgcaggtcagcagcaagccgttgttaacaatgct
tggttagaaatctcccaaagcgcgctggattttaatactaagaaagtgcaggcgttgctg
aacggtaaatcaacgctttgcgctattttgaaaggcgatgcttacggccacgatcttgct
ttagtggctccagtcataatgaaaaataacgtacagtgcatcggcgtggctagcaatcag
gagctaaagactgttagagaattgggctttcaggggcgtttgatgcgcgtaagaaacgcc
actgagcaagagatgcgacaggcgatagactatgacgttgaagagcttatcggcagtctg
gatatggcaaaacgactagacgctctggctgcggggcgagaaaaagcgctgcgcattcat
ctggcattaaactctggtggcatgtcgcgtaacgggcttgaagtgagtcgtgatgcgggt
ttagaagaggctaaggctatttcggcactgaagcatttgaaagttgtaggcattatgtcg
cactacccggaagaagatgttgccaaggtgaaatctgacctagcgcgttttcagaagcag
gcagcccgcgtgctggaagtgacgggcattcctcgtgagcaggttaaacttcacgtcgcc
aatacgtttgctaccctcacggtacccgattcatggttggatatggtgcgggttggcggt
gtgttttatggcgacaccatcgccagtactgaatatcagcgagtgatgactttcaaatcg
aatattgcctcgctaaaccgttatccgaaagggaataccgttggctacgatcgcacctat
acgcttaagcgagattctcttttagctaatatccccttggggtattccgatggctatcgc
cgcgttttcagtaatgcaggacacgtgctgattcaggggcagcgcctgccggtattgggg
aaaacctcaatgaataccatcgtggttgacgttacagatttgaaaaacgtcacctcaggg
gaagaggttgtcctgtttggtaaacagggcaaggcagagattaaagcggaagagattgaa
gacattagcggagcactgtttaccgaaatgtctatcctgtggggagcgacgaatccccgc
attttagtcgattga

DBGET integrated database retrieval system