KEGG   Leminorella richardii: NCTC12151_03276Help
Entry
NCTC12151_03276   CDS       T05503                                 

Gene name
tufA_2
Definition
(GenBank) P-43
  KO
K02358  elongation factor Tu
Organism
lri  Leminorella richardii
Brite
KEGG Orthology (KO) [BR:lri00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lri03012]
    NCTC12151_03276 (tufA_2)
   03029 Mitochondrial biogenesis [BR:lri03029]
    NCTC12151_03276 (tufA_2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lri04147]
    NCTC12151_03276 (tufA_2)
Translation factors [BR:lri03012]
 Eukaryotic Type
  Elongation factors
   NCTC12151_03276 (tufA_2)
 Prokaryotic Type
   NCTC12151_03276 (tufA_2)
Mitochondrial biogenesis [BR:lri03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NCTC12151_03276 (tufA_2)
Exosome [BR:lri04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCTC12151_03276 (tufA_2)
  Exosomal proteins of breast cancer cells
   NCTC12151_03276 (tufA_2)
  Exosomal proteins of colorectal cancer cells
   NCTC12151_03276 (tufA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: SQI43838
UniProt: A0A2X4V6L7
LinkDB All DBs
Position
1:complement(3498821..3500005)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDAEWEKKIIELAEALDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGTIT
PHTEFVSEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMV
VTLIAPIAMDEGLRFAIREGGRTVGAGVVAKIVK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccacggtaaaacaaccctgactgctgctatcaccaccgtactggctaaaacctac
ggcggtagcgcacgtgcattcgaccagatcgataacgcgccagaagaaaaggctcgtggt
atcaccatcaacacttctcacgttgaatatgacaccccgactcgccactacgcgcacgtt
gactgcccagggcacgccgactacgttaaaaacatgatcactggtgctgctcagatggac
ggcgctatcctggttgttgctgcgactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgccaggtaggcgttccttacatcatcgtgttcctgaacaagtgcgacatg
gttgatgacgaagagctgctggaactggtagaaatggaagttcgtgaacttctgtctcag
tacgacttcccgggcgacgatacgccggttattcgcggttcagcgctgaaagcgctggaa
ggtgacgccgagtgggaaaagaaaatcatcgagctggcggaagcgctggatacttacatt
ccagagccagagcgtgcgattgacaagccgttcctgctgcctatcgaagacgttttctct
atctctggccgtggtactgtagtcaccggtcgtgtagagcgcggcatcatcaaagttggt
gaagaagtggaaatcgtgggaatcaaagacaccaccaagaccacctgtactggcgttgaa
atgttccgtaagctgctggacgaaggccgtgcaggtgagaacgttggtgttctgctgcgt
ggtactaagcgtgacgaaatcgaacgtggtcaggtactggctaagccaggcaccatcact
cctcacacagaattcgtgtcagaagtgtatatcctgagcaaggatgaaggcggtcgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacgactgacgtgaccggc
accatcgaactgccagaaggcgtagagatggtaatgccaggcgataacatccagatggta
gttacgctgattgccccaatcgcgatggacgaaggtctgcgcttcgcaatccgcgaaggc
ggccgcaccgttggcgcgggcgttgttgccaagatcgtcaaataa

DBGET integrated database retrieval system