KEGG   Lactobacillus rhamnosus Lc 705: LC705_01017Help
Entry
LC705_01017       CDS       T00990                                 

Gene name
natA
Definition
(GenBank) ABC transporter, Na efflux transporter ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lrl  Lactobacillus rhamnosus Lc 705
Brite
KEGG Orthology (KO) [BR:lrl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lrl02000]
    LC705_01017 (natA)
Transporters [BR:lrl02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    LC705_01017 (natA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_29 AAA_22 AAA_23 Zeta_toxin SbcCD_C AAA_15 MukB Msg2_C
Motif
Other DBs
NCBI-ProteinID: CAR89856
LinkDB All DBs
Position
1010345..1011241
Genome map
AA seq 298 aa AA seqDB search
MLEVKDLVKTFGTMTAVDHVSFTVKPGEIMGLIGQNGAGKTTTFRMILNFLTPDAGTISW
NGQPLTAKDYDIIGYLPEERGLYPKMRVQDQIVYFARLRGMKTAEIKARIPEWLERFQVK
GRATDKIKDLSKGNQQKVQVIATMIHMPKLVILDEPFSGLDPVNASLLMAGIEMLKDNGA
AIIYSSHDMANVEAISDHLVMLKQGRMVLNGAVNAIRESFGRTKLFIESGLSEAELQAFD
GVTHLRRHGQEFELTLADPAVGRQIFTQAVANGYIPEFRQQPPTLDEIFRLKVGESNA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagtcaaggatctggtcaagactttcggtaccatgaccgccgttgatcatgtg
agcttcacggtaaaacccggtgagatcatgggattaatcgggcaaaatggcgcgggtaaa
accacgacttttcgaatgattctgaatttcttgacgcctgatgccggtaccatcagctgg
aacgggcaaccattgacggccaaagattacgacatcattggctatttgccggaagaacgc
gggttatatcctaaaatgcgggtgcaggatcaaattgtttattttgcccggttgcggggt
atgaaaacagctgaaatcaaagcgaggattccggaatggctggaacggtttcaggttaaa
ggtagggctacggataagatcaaggatttaagcaaaggcaatcagcaaaaagttcaagtg
atcgcgacaatgatacatatgccaaagctggtcattcttgacgaaccgttttccggactc
gacccggttaatgccagtttgttaatggccggcatcgagatgcttaaagacaacggcgca
gcgattatttattccagtcatgatatggctaatgttgaggctatttcggatcatttggtg
atgttgaaacaaggtcgcatggtcttaaatggtgctgtaaatgccattcgggaaagcttt
ggccgaaccaaactgtttattgaatctggcttgtcggaagcagaattgcaagcatttgac
ggggtaacacatcttcgccgacacggacaggagtttgagttaacactggctgatccagca
gtgggtcgacaaatatttacccaagctgtggcgaatggctacataccggaatttcgccaa
caaccgcctacgcttgatgaaattttccgcctgaaagtaggtgagtcgaatgcataa

DBGET integrated database retrieval system