KEGG   Lactobacillus rhamnosus Lc 705: LC705_01098Help
Entry
LC705_01098       CDS       T00990                                 

Gene name
gatA
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00970  Aminoacyl-tRNA biosynthesis
lrl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LC705_01098 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lrl03029]
    LC705_01098 (gatA)
Enzymes [BR:lrl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LC705_01098 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LC705_01098 (gatA)
Mitochondrial biogenesis [BR:lrl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LC705_01098 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAR89937
LinkDB All DBs
Position
1082840..1084294
Genome map
AA seq 484 aa AA seqDB search
MDYFKTNLDQLHEQLRSGKLTSRQLVDETLAGIDKIDPEVAAFLAINADGAKKQAAAIDE
AGIADDQPLSGVPIAIKDNIVTKGVVTTAASKILENFNPIYDATVMQKLAAAGAINVGKT
NLDEFAMGSSTENSAFKTTKNAWDHSRVPGGSSGGSAAAVAAGEVIAALGSDTGGSIRQP
AAFNGIVGFKPTYGRVSRWGLIAFSSSLDQIGTLTRGVKDAAQILNVIAGHDERDSTTAD
TPVPDFTAKIGQSIKGMKIALPKEYLGEGVDPEVAAKIKAAAKQLEALGATVSEVSLPHT
QYAVPSYYIIASSEASSNLQRFDGIRYGFRAKDVHNIEDVYVRSRSEGFGPEVKRRIMLG
TFSLSAGFYDAYFKKAGQVRTLITRDFEAVFEDYDLIIGPTTPTVAFKIGEKVTDPVTMY
MNDILTIPVNLAGLPAASVPAGFVDGLPVGLQLIGKHFDESTIFQVAAAFEAQNDYLAQI
PGGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtggattattttaaaacgaatcttgatcaacttcatgaacagttacgttctggcaagctg
accagtcgccagttggttgatgagacgctggctggtatcgataaaatcgatccggaagtg
gccgctttccttgccataaatgcggacggtgccaagaagcaggcagccgcaattgacgaa
gccggtattgccgatgatcagccgttatccggggtgccgatcgcgattaaagataacatc
gtgactaaaggcgttgtgacaaccgccgcttcgaaaattctggaaaactttaatcccatt
tatgatgcaacggtgatgcagaagctggccgctgccggtgcgattaatgtgggtaaaacc
aatctggatgaatttgcgatggggtcttcaactgaaaactctgctttcaaaacgactaaa
aatgcttgggatcacagccgcgttcccggtggctcttcaggtggatcagcagcggctgtg
gcggccggtgaagtgattgccgctttgggtagtgacacgggtggttcgattcgccaacct
gctgctttcaacggcattgtcggctttaaaccaacttatggccgggtttcccggtggggg
ctcatcgcgtttagttccagtctggatcagattggcacgttgacgcgcggggttaaagat
gccgctcagattctgaatgtgattgccggacatgatgaacgcgacagcaccactgccgat
acgccggtaccggacttcacggccaagatcgggcaatcaatcaaaggcatgaagattgcg
ttgcctaaagaatatttgggtgaaggggtcgaccctgaagtggcagctaaaatcaaagct
gcagctaagcaacttgaagctttaggcgcaaccgtgtcagaagtttccttgccacacacc
caatatgccgtaccatcttattacatcatcgccagttccgaagccagttccaacttacaa
cgttttgacgggattcgttacggtttccgtgccaaagatgtccacaacattgaagatgtc
tatgttcgttcccgttccgaaggctttggacccgaagtaaagcggcggatcatgttagga
accttcagtttgtctgctggtttttatgacgcctacttcaaaaaagccgggcaggtacgt
acgttaatcacccgggattttgaagctgtcttcgaggattatgatttaatcattggaccg
accacgccaactgttgccttcaagattggggaaaaagtcaccgatccggttaccatgtat
atgaatgatattttgacgatcccggtcaacttagctggcttaccggctgcctctgttccg
gctggatttgttgatggtttgcctgtgggcttgcaactgattggcaaacatttcgatgaa
agtacgatcttccaagttgccgcagcttttgaagcgcaaaacgactacttagcacagatc
ccgggaggcaagtaa

DBGET integrated database retrieval system