KEGG   Lactobacillus rhamnosus Lc 705: LC705_02695Help
Entry
LC705_02695       CDS       T00990                                 

Gene name
rpiA
Definition
(GenBank) Ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00030  Pentose phosphate pathway
lrl01100  Metabolic pathways
lrl01110  Biosynthesis of secondary metabolites
lrl01120  Microbial metabolism in diverse environments
lrl01130  Biosynthesis of antibiotics
lrl01200  Carbon metabolism
lrl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LC705_02695 (rpiA)
Enzymes [BR:lrl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     LC705_02695 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind CoA_trans
Motif
Other DBs
NCBI-ProteinID: CAR91534
LinkDB All DBs
Position
complement(2730133..2730822)
Genome map
AA seq 229 aa AA seqDB search
MDQNKLKQEAAQRAAEFVEDGMTIGLGTGSTVFYLVEAIAKRIKEEHLSLNGVATSIRTR
KQAESLGIPMKELDGVDKIDLTIDGADEVDKHFQGIKGGGRSHLIEKIVAINSARNIWIV
DETKLVDTLGKFPLPLEVIPFGSGKLLQRLADEGLKPAYRLNEDGSKALTDSKNYIIDLH
LGRIEHPHLLAEWLNKQVGIVEHGLFLDLVKTVVVGTTHGPEILDAHRG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaataagttgaagcaagaagccgctcaacgggcagcagagtttgttgaagac
gggatgacaattggcttgggaacgggctcgacggttttttatctcgttgaagccattgca
aagcggattaaagaggagcatcttagtctgaatggtgtggccacaagcattcggacgcgg
aaacaggcggagtcgttggggatcccgatgaaagaactggacggggttgacaaaattgac
ctcaccattgacggtgccgatgaagtcgacaagcattttcagggtattaaaggcggcggg
cgctcacatctgatcgaaaaaattgttgcgattaattcggcacgtaatatttggatcgtg
gacgaaaccaaactggtggacacacttggaaagtttccgttgccgctagaagtgattccg
tttggtagtggcaagctgttacagcggttggcggatgaaggcctgaaaccagcttatcgt
ttgaatgaggatggcagcaaagctttgacggattctaagaattacattatcgatctgcat
cttggccggatcgaacacccgcatttgttggcagaatggctcaataagcaggttgggatt
gtcgagcacggattgttccttgatctggttaaaacggtggttgtcggaacaacgcatggt
ccggaaattttggatgctcatcgtggatag

DBGET integrated database retrieval system