KEGG   Lactococcus raffinolactis: CMV25_04520
Entry
CMV25_04520       CDS       T05231                                 

Definition
(GenBank) PTS mannose/fructose/sorbose transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
lrn  Lactococcus raffinolactis
Pathway
lrn00051  Fructose and mannose metabolism
lrn02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lrn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CMV25_04520
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    CMV25_04520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lrn02000]
    CMV25_04520
Transporters [BR:lrn02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    CMV25_04520
SSDB
Motif
Pfam: EII-Sor TMEM208_SND2
Other DBs
NCBI-ProteinID: ATC61188
UniProt: A0A2A5S981
LinkDB
Position
complement(909407..910201)
AA seq 264 aa
MSVIQIVLLLIVAGITGIGSVVDEAQTHRPLVACTLVGIVLGDIQTGIILGGTLEMMALG
WMNVGLAMAPDTAIASVISTILVINSHQGIGEGIAIAVPLAAAGQALTIFVRTITVFFIH
KADEMAKKGNYKGIERAHLLAMSLQALRVMIPTLIISLISATAVQNFLSSIPEVITRGLQ
IGGGIIVVVGYAMVINMMDVPYLKPFMYAGFLFAAFTNFNLVGFGALGLIAAMIYLQLKY
NGQPQVAAAPAGVVFDDDDDDLDA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagtgtgattcaaattgttttacttttaattgtcgcagggattactggtatcggatca
gtagttgacgaagcgcaaacccatcgaccgctggttgcttgtacgttagttgggattgtc
ttaggtgatattcaaactggtattattctaggtgggacattggaaatgatggctttgggc
tggatgaacgttggacttgccatggcaccagatacagccattgcctctgttatttctacg
attcttgttattaattcacaccaaggtattggcgaagggattgcaattgcagtacctctt
gcagcagctggtcaagctttgactatttttgttagaacaatcacggtattctttattcac
aaagctgacgaaatggctaaaaaaggtaattataaaggtattgagcgtgctcacttactc
gctatgagcttgcaagcgctccgtgttatgattccaactttaatcatcagtctcatttct
gcaacagctgttcaaaatttcttgagctctattccagaagtcatcacgcgcggtcttcaa
attggtggtggtatcatcgttgtcgttggttatgctatggtgattaacatgatggatgtg
ccttatttgaaaccctttatgtatgcaggcttcctattcgcagcctttactaacttcaac
ttagttggtttcggtgcattaggcttgattgcagccatgatttacctacaattaaaatat
aatggtcaaccacaagtagcagcagcgcctgcaggtgtggtatttgatgatgatgacgat
gatttggacgcttag

DBGET integrated database retrieval system