KEGG   Lactococcus raffinolactis: CMV25_10505Help
Entry
CMV25_10505       CDS       T05231                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lrn  Lactococcus raffinolactis
Pathway
lrn00010  Glycolysis / Gluconeogenesis
lrn00030  Pentose phosphate pathway
lrn00051  Fructose and mannose metabolism
lrn00052  Galactose metabolism
lrn00680  Methane metabolism
lrn01100  Metabolic pathways
lrn01110  Biosynthesis of secondary metabolites
lrn01120  Microbial metabolism in diverse environments
lrn01130  Biosynthesis of antibiotics
lrn01200  Carbon metabolism
lrn01230  Biosynthesis of amino acids
lrn03018  RNA degradation
Module
lrn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lrn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMV25_10505 (pfkA)
   00030 Pentose phosphate pathway
    CMV25_10505 (pfkA)
   00051 Fructose and mannose metabolism
    CMV25_10505 (pfkA)
   00052 Galactose metabolism
    CMV25_10505 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    CMV25_10505 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CMV25_10505 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lrn01009]
    CMV25_10505 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lrn03019]
    CMV25_10505 (pfkA)
Enzymes [BR:lrn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CMV25_10505 (pfkA)
Protein phosphatases and associated proteins [BR:lrn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CMV25_10505 (pfkA)
Messenger RNA biogenesis [BR:lrn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CMV25_10505 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ATC62263
UniProt: A0A290Q1C8
LinkDB All DBs
Position
complement(2127829..2128836)
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAIYEGMEVFGINYGYAGMVAGDIFPLASRGVGGK
ISQGGTFLYSARFPEFAELEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDYTIGFDTAVTTALEAIDKIRDTSSSHKRTFIVEVMGRHAGDIALWA
GIGAGADEILIPEQDFDVNELVASIKNGYKNGKNHNIIVLAEGVMTGAELAEKIKAAGDD
SDLRVSTLGHIQRGGTPTARDRVLASWMGARAVELLKEGRGGLAVGIHNEKLVESPILGT
AEEGALFSLDNGKIVVNNPHKANLDLYKLNKEISS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgccgttttaaccagtggtggcgacgcccctggtatgaatgccgctatt
cgtgccgttgttcgtaaagccatttacgaaggtatggaagtattcggtattaactatggt
tatgctggtatggttgctggcgacatattccctttggcaagtagaggagttggcggaaaa
atttcacagggtggcacattcttgtactctgcgcgctttcctgaatttgctgagcttgaa
ggtcagcttgctggtattgaacagcttaaaaaacatggtatcgaaggtgttgttgttatc
ggtggcgatggttcataccatggtgcgatgcgcttaacagagcatggcttcccagctatt
ggtttaccaggaacgattgataacgatatcgtcggaactgactataccattgggtttgat
actgctgtgacaacagcactagaagcgattgacaaaatccgtgatacatcatcttcacat
aaacgcacgtttatcgttgaagtgatgggacgtcacgctggagatatcgcgctttgggct
ggtatcggtgcaggtgctgatgaaattctcatccctgaacaagatttcgatgtgaatgag
ttagttgcatcaatcaaaaatggctacaaaaatggtaaaaaccataatatcatcgtcctt
gcagaaggtgtaatgaccggtgcagaacttgcagagaaaattaaagctgctggtgatgat
agtgatcttcgtgttagtactttgggtcatatccaacgtggtggtacaccaactgcccgt
gaccgtgttcttgcatcatggatgggcgcccgcgctgtagaattacttaaagaaggtcgt
ggtggccttgcagtcggtattcataacgaaaaattggttgaaagcccaattttaggaaca
gcagaagaaggtgctttgtttagtcttgataatggtaaaatcgttgtcaataatcctcac
aaagccaaccttgatttgtacaaacttaacaaagaaatttcatcataa

DBGET integrated database retrieval system