KEGG   Lactococcus raffinolactis: CMV25_10925Help
Entry
CMV25_10925       CDS       T05231                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lrn  Lactococcus raffinolactis
Pathway
lrn00500  Starch and sucrose metabolism
lrn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CMV25_10925
Enzymes [BR:lrn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CMV25_10925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ATC62424
UniProt: A0A290Q1Q1
LinkDB All DBs
Position
pWiKim0068-1:complement(3767..5242)
Genome map
AA seq 491 aa AA seqDB search
MKTILQAFEWYLPSDSQHWNNIKENIPDLKKLGFSGLWLPPASKAASGVEDVGYGTYDLF
DLGEFDQKGTIPTKYGTKDEYLDLINKLHHNNIEVYADIVFNHMMGADETETIEADIKAE
DNHLHNIENNKTVEVWTKFTFPGRQGKYDNYIWTWHNFTGIDYDERKNQEEILEFEGHEW
DENVDSENNNFDYLMGADLDFTVSETVEQLEKWGHWFSEMTKIDGFRLDAIKHIDFKYFD
KWLEQRAKQLDKKLFIVGEYWSEDLGKLEYYLEQSGDKIQLFDVPLHFNLKEASSTNGEF
DMRTLFDHTLTASQPELSVTFVDNHDTQEGQALQSWIPAWFKEHAYSLILLRKKGTPTVF
WGDLYGIPSHNVNPVGDNLRTMIALRKGSEFLRENDYFDHPDIIGWTNILKIDNKEYGLS
CILTNKNGGSKYMIIDKAYAGKVYIDLFGRHEIPITLDQNGGAEFYVNDGSVSVWVDKEI
VSKIDQMNFQN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatccttcaagcttttgaatggtatttaccctcagattctcagcactggaat
aatataaaagagaatattcccgacttaaaaaagttaggattttcaggattatggttacct
ccagcttccaaggctgcttctggagttgaagatgttggctatgggacctatgatttattc
gacttaggagaatttgatcaaaaagggacaattcctacaaaatatgggactaaagatgaa
tatcttgacttaattaataaactacaccacaacaatattgaagtgtatgccgatatcgtt
tttaatcacatgatgggtgctgatgaaacagaaactattgaagctgatattaaagcagaa
gataatcatcttcataacatcgaaaataataaaactgttgaagtttggaccaaatttaca
tttccaggaagacaaggaaaatacgacaattatatatggacctggcacaactttacagga
attgattatgatgaaaggaaaaatcaagaagaaattcttgaatttgaaggacatgaatgg
gatgagaatgtagattcagagaataataattttgattatttaatgggtgctgatcttgat
tttactgtttcagaaacggttgaacaacttgaaaaatgggggcattggttttcagaaatg
acaaaaattgatggttttcgattagatgcaattaaacatatcgatttcaaatattttgat
aaatggcttgaacagagagcaaagcaattggataaaaaactttttattgttggcgagtac
tggtctgaggatcttggcaaattagagtattatctagaacaatccggtgataaaatacaa
ttatttgatgtaccactacattttaatctgaaagaagcctcttcaaccaatggagaattt
gatatgcgtactctttttgatcacacactcactgccagccagccagaactctcggtcact
tttgttgataaccatgatactcaagaaggacaggctcttcaatcttggattccagcttgg
tttaaagagcacgcttatagcttaattttacttcgcaaaaaaggaactcctactgtcttt
tggggagatttatatgggataccctcacataatgttaatcctgtaggtgataacttaaga
actatgatagcactacgtaagggctctgagtttttaagggaaaatgattattttgatcat
cctgatattattggatggacaaatattttaaaaatagataataaggaatatggattatca
tgtattttaactaataaaaatggtggctcaaaatatatgataattgataaggcgtacgca
ggtaaagtttatatagatttatttggaagacatgaaatacctattacgctggatcaaaat
ggtggagctgaattttacgtcaatgatggaagtgtttcggtttgggtagataaggaaatt
gtttcaaaaatcgatcaaatgaactttcaaaactaa

DBGET integrated database retrieval system