KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_0991Help
Entry
LOCK900_0991      CDS       T02730                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
lro00970  Aminoacyl-tRNA biosynthesis
lro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lro00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LOCK900_0991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lro03029]
    LOCK900_0991
Enzymes [BR:lro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LOCK900_0991
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LOCK900_0991
Mitochondrial biogenesis [BR:lro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LOCK900_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGP70805
LinkDB All DBs
Position
962475..963929
Genome map
AA seq 484 aa AA seqDB search
MDYFKTNLDQLHEQLRSGKLTSRQLVDETLAGIDKIDPEVAAFLAINADGAKKQAAVIDE
AGIADDQPLSGVPIAIKDNIVTKGVVTTAASKILENFNPIYDATVMQKLAAAGAINVGKT
NLDEFAMGSSTENSAFKTTKNAWDHSRVPGGSSGGSAAAVAAGEVIAALGSDTGGSIRQP
AAFNGIVGFKPTYGRVSRWGLIAFSSSLDQIGTLTRGVKDAAQILNVIAGHDERDSTTAD
TPVPDFTAKIGQSIKGMKIALPKEYLGEGVDPEVAAKIKAAAKQLEALGATVSEVSLPHT
QYAVPSYYIIASSEASSNLQRFDGIRYGFRAKDVHNIEDVYVRSRSEGFGPEVKRRIMLG
TFSLSAGFYDAYFKKAGQVRTLITRDFEAVFKDYDLIIGPTTPTVAFKIGEKVTDPVTMY
MNDILTIPVNLAGLPAASVPAGFVDGLPVGLQLIGKHFDESTIFQVAAAFEAQNDYLAQI
PGGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtggattattttaaaacgaatcttgatcaacttcatgaacagttacgttctggcaagctg
accagtcgccagttggttgatgagacgctggccggtatcgataaaatcgatccggaagtg
gccgctttccttgccataaatgcggacggtgccaagaagcaggcagccgtaattgacgaa
gccggtattgccgatgatcagccgttatccggggtgccgatcgcgattaaagataacatc
gtgactaaaggagttgtgacaaccgccgcttcgaaaattctggaaaactttaatcccatt
tatgatgcaacggtgatgcagaagctggctgctgccggggcgattaatgtgggtaaaacc
aatctggatgaatttgcgatggggtcttcaactgaaaactctgctttcaaaacgactaaa
aatgcttgggatcacagccgcgttcccggtggctcttcaggtggatcagcagcggctgtg
gcggccggggaagtgattgccgctttgggtagtgacacgggcggttcgattcgccagcct
gctgcttttaacggcattgtcggctttaaaccaacgtatggtcgggtttcccggtggggg
ctcatcgcgtttagttccagtctggatcagattggaactttgacgcgcggggttaaagat
gccgctcagattctgaatgtgattgccggacatgatgaacgcgacagcacgaccgctgat
acgccggtaccggacttcacggccaagatcgggcaatcaatcaaaggcatgaagattgcg
ttgcctaaagaatatctgggtgaaggggtcgaccctgaagtggcagctaaaatcaaagct
gcagctaagcaacttgaagctttaggcgcaaccgtgtcagaagtttccttgccacacacc
caatatgccgtaccatcttattacatcatcgccagttccgaagccagttccaacttacaa
cgttttgacgggattcgttacggtttccgtgccaaagatgtccacaacattgaagatgtc
tatgttcgttcccgttccgaaggctttggacccgaagtaaagcggcggatcatgttagga
accttcagtttgtctgctggtttttatgacgcttacttcaaaaaagccgggcaggtccgc
acgttaatcacccgggattttgaagctgtcttcaaggattatgatttaatcattggaccg
accacgccaactgttgccttcaagattggggaaaaagtcaccgatccggttaccatgtac
atgaatgatattttgacgatcccggtcaacttagctggcttaccggctgcctctgttccg
gctggatttgttgatggtttgcctgtgggcttgcaactgattggcaaacatttcgatgaa
agtacgatcttccaagttgccgcagcttttgaagcgcaaaacgactacttagcacagatc
ccgggaggcaagtaa

DBGET integrated database retrieval system