KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_1291Help
Entry
LOCK900_1291      CDS       T02730                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
lro00010  Glycolysis / Gluconeogenesis
lro00020  Citrate cycle (TCA cycle)
lro00620  Pyruvate metabolism
lro01100  Metabolic pathways
lro01110  Biosynthesis of secondary metabolites
lro01120  Microbial metabolism in diverse environments
lro01130  Biosynthesis of antibiotics
lro01200  Carbon metabolism
Module
lro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOCK900_1291
   00020 Citrate cycle (TCA cycle)
    LOCK900_1291
   00620 Pyruvate metabolism
    LOCK900_1291
Enzymes [BR:lro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LOCK900_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N DUF1780
Motif
Other DBs
NCBI-ProteinID: AGP71100
LinkDB All DBs
Position
1232192..1233847
Genome map
AA seq 551 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDEIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPATQPAAAQPAAAPAAATDASAGNAPAAKSVYQFKLPEL
GEGLAEGEIVKWAVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETATVG
EALVDIDAPGHNDTPVASGTAAAPQANTDTAAPAAAPAAAGSVPAITDPNREILAMPSVR
QYAREQGIDISQVPATGKHGRITKADIDAFKAGAPAAAPAQPAATSAPKAAQPAPAATPA
APKPQPVAPYVSNSSEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDEVEVSKLMAH
RKKYKQYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIATNT
DHGLYVPVIKNADAKSMFEIAKEISDNAQKAYDSKLKPDEMRGGSMTISNVGSIGGGWFT
PVINQPEVAILGVGKIAKEPYVNADNEIVVGNLLKLSLSYDHRLIDGALAQTALNLMDKL
LADPDLLLMEG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgagatcgtc
aagtgggacgtgaagccaggcgatgagatcaaggaggatgacaccctgcttgaagttcaa
agtgataaaagtgtcgaggaaattccttcaccggtttcagggaaaattttgaagatttta
gtaccagaaggtgaaaccgcttcagtcggtgatttactggttgaaattgatgatggctcc
ggtccggccacacaacctgcagccgcacaacctgcagccgcacctgccgcggcaaccgat
gcttcagcaggcaatgcgccagctgctaagtcggtctatcaatttaaattaccagaactt
ggtgaaggtctggcggaaggtgaaattgtcaagtgggcggttaaacccggtgaccagatc
aaagaagacgatacactgcttgaggttcaaagcgataaaagcgttgaagagattccatca
ccagttgccggaaccgttgttaaaattttagtaccagaaggtgaaaccgcaactgttggc
gaagcgctggttgatattgacgcaccggggcataatgatacgccggttgcatcgggtacc
gctgcagcaccccaagccaatacggatacggctgcaccggccgcggcaccagctgctgcc
ggatcagtaccggccatcaccgatccaaatcgggaaattctggcgatgccgtctgttcgc
caatatgcacgcgaacaaggcattgatatttcacaagtgccagcaactgggaagcatggg
cgcattaccaaagccgatatcgatgcctttaaagcaggggcacctgctgcagcacctgcg
cagccagcagcaacctccgcgcctaaagcagcgcaaccagctccagcagcaacaccggca
gcgccaaaaccgcagccagtcgcgccttacgtttcaaacagcagtgaagccgagctggag
actcgcgagaagatgacgccaacgcgcaaggcaattgccaaggcaatgttagcctcgaaa
caacggagcccgcatgtcacgagctttgacgaggttgaagtgtccaagttaatggcgcat
cggaagaagtacaagcagtacgcggctgataaaggcattaaattaacgttcttgccatac
atcgttaaagctttggtcacggtattgcgtgaatatccagaatttaatgcgtcaattgac
gacaccaccgatgagattgtttacaaacattactttaatatcgggattgccacgaacacg
gatcatgggttatacgtgccggtcatcaagaatgctgatgccaagagcatgttcgaaatt
gccaaggaaattagtgacaatgcacaaaaggcatatgacagcaagttgaagccagatgag
atgcgcggcggttccatgaccattagtaacgttggttcaattggtggcggctggttcaca
ccggtgatcaatcagccggaagttgccatccttggtgtcggtaaaattgctaaagagcca
tatgtcaacgctgataatgaaattgttgtcggtaacctgttgaagttgagcttgagttat
gatcatcgcttgattgatggtgctttggcgcaaaccgcattgaatctcatggataaattg
ttagcagaccctgatctgctgttgatggagggataa

DBGET integrated database retrieval system