KEGG   Lactobacillus reuteri TD1: N134_02550Help
Entry
N134_02550        CDS       T02745                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
lrr00473  D-Alanine metabolism
lrr00550  Peptidoglycan biosynthesis
lrr01100  Metabolic pathways
lrr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lrr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N134_02550
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N134_02550
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    N134_02550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lrr01011]
    N134_02550
Enzymes [BR:lrr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N134_02550
Peptidoglycan biosynthesis and degradation proteins [BR:lrr01011]
 Precursor biosynthesis
  Amino acid ligase
   N134_02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AGR63916
UniProt: S5N4D8
LinkDB All DBs
Position
571892..573028
Genome map
AA seq 378 aa AA seqDB search
MTQKLHIALLFGGNSSEHDVSKRSAHNIYDALDKEKYDVSLFMFTKDGILLGNEDSQKIF
DGEPEDQVVAEAYQKMDMSSPLAPIMALNEQKEIDFFFPVIHGNLGEDGTIQGLFKLLNK
PYVGSNIAASAMSFDKDLTKKIISQAGIRNTPYVVVTPENRADYSWGRIEEKLGNLTFVK
PAKQGSSVGIHRVTNAEEYEKALDDAFKYDYKILVEQGIANPQEIEISILGNEHPIASKL
GAVRVPKDDPFYDYENKFVDASGVVFELPVKLPQYLVDEITDMALKAYKALGMKGMARID
FLVDSNNVPYLGEPNTLPGFTNISLYPQMWEVSGISYSDLIDRLIQLGLQEFERNSKIKY
DFRKLGTERVGQKKYNED
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaattacacatcgctttattatttggtggcaactcctctgaacatgatgtg
tcaaagcgatcagcacataatatctatgatgctcttgataaggaaaagtatgatgtaagt
ctttttatgtttacaaaggatggaattctattaggcaatgaggattcccaaaagatcttt
gatggcgaaccagaagaccaagtggtagcggaagcatatcaaaagatggatatgagtagt
ccattagcaccaattatggccttaaacgaacaaaaggaaattgatttcttcttccctgtt
atccatggtaatttaggtgaagatggtacaattcaaggtctctttaagctccttaataag
ccatacgttggttcaaatattgcagctagtgcgatgtcttttgacaaggatcttactaag
aagattattagtcaagctggtattcgcaacaccccttatgtagtagttacgccagaaaac
cgggctgactattcatggggccggattgaagaaaaattaggcaatctcacttttgtaaag
cccgctaagcaaggttcctccgttggaattcatcgagttactaatgctgaagaatatgaa
aaagcgttagatgatgcttttaagtatgattacaagatcttagtagaacaggggatcgct
aatcctcaagaaattgagatttcaatcttaggaaatgaacacccaattgcctctaagcta
ggagctgtacgtgtacctaaggatgatccattctatgattacgaaaataagtttgtggat
gccagtggcgttgtttttgaacttcctgttaaattaccacaatacttagttgatgaaatt
acagacatggctttgaaggcatacaaggcattaggaatgaaggggatggctcggattgac
ttcttagttgacagcaataatgtcccttatcttggtgaaccaaatactttaccaggattt
actaacattagtttgtaccctcaaatgtgggaagtttctggtatttcatattcagacttg
attgatcggttaattcaattaggattacaagaatttgaacgaaacagcaagattaagtac
gattttcgtaagcttggtactgaacgagttggtcaaaagaaatataatgaagactaa

DBGET integrated database retrieval system