KEGG   Lactobacillus reuteri TD1: N134_02625Help
Entry
N134_02625        CDS       T02745                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
lrr00250  Alanine, aspartate and glutamate metabolism
lrr00410  beta-Alanine metabolism
lrr00430  Taurine and hypotaurine metabolism
lrr00650  Butanoate metabolism
lrr01100  Metabolic pathways
lrr01110  Biosynthesis of secondary metabolites
lrr01120  Microbial metabolism in diverse environments
lrr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    N134_02625
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N134_02625
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N134_02625
   00430 Taurine and hypotaurine metabolism
    N134_02625
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    N134_02625
Enzymes [BR:lrr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     N134_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGR65020
UniProt: S5NRL7
LinkDB All DBs
Position
complement(587594..589000)
Genome map
AA seq 468 aa AA seqDB search
MAGLYGKNDKEKRDVLDPIFGSYTSDHALSKYELNQESVAPEVAYRIVKDQLIDEGNARE
NLATFCQTYMEPKATEIMAETMQKNAIDKDEYPRTAELENRCVNIIANLWHGQKDEDYIG
TSTVGSSEGCMLGGLAMKFAWRERAKKLGLDIHARKPNLVISSGYQVCWEKFATYFDVEL
RTVPMDEEHQSLNMNTVMDYVDEYTIGIVGIMGITYTGRYDDIAKLNDLVEEYNKTTDYK
VYIHVDAASGGFYAPFMEPDIKWDFQLKNVVSINSSGHKYGLVYPGIGWVLWRDKKFLPE
SLIFKVQYLGGELPTMAINFSRSASQIIGQYYNFVRFGFDGYQKIQKRTHDVAVYLATEI
EKMGMFEMVNDGSQLPIICYKLKDLTAQNWSLYDLADRLRMQGWQVPAYPLPKNLDTIEV
QRIVCRADFGMSRAHEFIDDMQRDIKALNNSTLVGKKTTELKKYGFAH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcaggactatatggaaaaaatgataaggaaaagcgtgacgtgttagatccaattttt
ggctcatacacttctgatcatgctttatcaaaatacgaattaaatcaagaatctgttgct
ccagaagtagcttatcgtattgtaaaagatcaactaattgatgaaggtaacgctcgtgaa
aacctagcaaccttctgtcaaacatacatggaacctaaagcaacggaaattatggcagaa
acgatgcaaaaaaatgctatcgataaggatgaatatccgcgaacagctgaattagaaaat
cgctgtgtcaatatcatcgctaatttgtggcatggtcaaaaagatgaagattatattgga
acttcaactgttggttcttctgaaggttgtatgcttggcggtctggcaatgaaatttgca
tggcgcgaacgggctaaaaaattaggacttgatattcatgctcgaaagccaaacttagta
atatcatccggttaccaagtttgttgggaaaaatttgcaacctattttgacgttgaactt
agaacagttccaatggacgaagaacaccaatcacttaatatgaataccgtaatggattat
gttgatgaatacactattggaatcgtcggtattatgggtattacttatactggccgttat
gatgatattgcaaaattaaatgatcttgttgaagaatataacaagactactgactataaa
gtatatatccatgttgatgcagcttctggtggtttctatgctccatttatggaaccagat
ataaaatgggattttcaacttaagaatgttgtttcaattaactcctctggtcacaagtat
ggattagtttatccaggaattggttgggttctttggcgtgataaaaagtttctacctgaa
agtttaatctttaaagttcaatacttgggcggtgaattgccgacaatggcgattaatttc
tcaagaagtgcttcccaaattattgggcaatattacaattttgttcggtttggttttgac
ggctatcaaaagatccaaaaacgtactcatgatgtagctgtttatctcgcaacggaaatt
gaaaaaatgggtatgtttgaaatggttaatgatggatcacaacttccgattatctgttat
aagctaaaagatctaactgctcaaaattggtcattatacgacttagctgatcgtctacga
atgcaaggttggcaagtccctgcctaccctctaccgaagaatttagatacaatagaagtg
caacgaattgtatgtcgagcagatttcggaatgagccgagcacatgaattcattgatgat
atgcaacgtgatattaaagctttaaacaactcgactttagttgggaaaaaaacaactgaa
cttaaaaagtatggctttgcacattaa

DBGET integrated database retrieval system