KEGG   Lactobacillus reuteri I5007: LRI_0455Help
Entry
LRI_0455          CDS       T02701                                 

Definition
(GenBank) multidrug transport protein
Organism
lrt  Lactobacillus reuteri I5007
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: AGN98664
UniProt: R9WEW6
LinkDB All DBs
Position
complement(471099..472607)
Genome map
AA seq 502 aa AA seqDB search
MNQEQQPVDINGQTYNRSLMIFVLLIGAFCTILNQTILSTAFPALMDAFNISTATVQWLT
TGFLMVNGIMIPVSAYLTSRFNTKSLFIIAMSTFEVGTILAWIAPSFAVLLAGRLIQAVG
VGINMPLMQNIMLTVYPPEKRGAAMGVNGLVIGLAPAIGPALSGWVIDSYSWRWLFGMIA
PITALVIIVSFFAVKNVIPNKKPHLDWLSVVISTLGFGNMLYGFSSVGDKGWTDPVVLST
IIIGVILVGILIMRQNKLDDPFLEFKVFESKEFSLATILSSIVMMAMVGVEFVIPLYLQI
IHGMTAFHSGLTLLFGALFMGIMSPITGNLFDRHGAKRLAFTGMFILTVGTIPFAFITRD
TPTIYIVFLYAVRMFGISMVMMPVTTAGMNSLPYNLISHGTAVNNTIRQVATSVGTAIMI
SVLTNITNSNRPAHSLLTQSPLQYKAKMFDATLMGYHAAFWFAIAFSLIGLFLTFFVTSG
NGIHLRLDSEDIAEPTDKGGMK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaagagcaacaacctgttgatattaatggtcaaacttataatcgttccttaatg
atctttgtcttattaattggagctttttgtactattttaaatcaaactattctttcaaca
gcctttccggcattaatggatgcttttaatattagtaccgccaccgttcaatggttaacg
actgggttcttaatggttaatgggattatgatccccgtaagtgcctacctaactagtcgt
tttaatactaaaagtctttttatcattgctatgtcaacctttgaagttggaacaatccta
gcatggatcgctccatcatttgccgttttattagccggtcgtcttatccaagcggtcgga
gtaggaattaacatgcccctaatgcaaaatattatgctgactgtttatcctcctgagaaa
cgtggtgctgcaatgggagtaaacggcttagttattggattagccccagcaatcggaccc
gctctatctggatgggttatcgatagttatagctggcggtggcttttcggaatgatcgcc
cccattactgctttagttatcattgttagtttttttgcagttaaaaatgttattcctaat
aaaaagccgcatcttgactggctttctgttgttatttcaacattaggatttgggaacatg
ctttatggattttcaagtgtcggtgataaggggtggacagatccagttgtcctttcaacc
attatcattggggtgattttagttggaattctaatcatgcggcaaaacaagctagacgat
ccgttccttgaattcaaggtctttgaaagcaaagaattctccctcgcaactatccttagt
tcaattgtaatgatggcaatggttggggtggaattcgtcatccctctttaccttcaaatc
attcatggaatgaccgccttccattcaggtcttacccttttatttggagcccttttcatg
ggaattatgagtccaattactgggaacttatttgaccgtcatggtgctaaacgcttagcc
tttacgggaatgtttatcttaactgttggaacaattccttttgcctttattactcgtgat
accccaactatttatattgtcttcttatatgcagtccggatgtttggtatttcaatggta
atgatgccagttactacggcgggaatgaattctcttccttacaatttaatctcgcacggt
acagctgttaacaataccattcgtcaagtcgctacttctgtgggaacagctatcatgatc
tctgttttgacaaatattaccaatagcaatcgacctgctcattcactgctgacacaatcc
ccattacaatataaagcaaagatgtttgatgctactttgatggggtaccatgcagcattc
tggtttgcaatcgccttctcactcattggtttattccttacattctttgttacaagtggt
aatggaattcacctccgccttgatagcgaagacattgcagaaccaactgataaaggaggg
atgaagtaa

DBGET integrated database retrieval system