KEGG   Lactobacillus reuteri I5007: LRI_0636Help
Entry
LRI_0636          CDS       T02701                                 

Definition
(GenBank) ABC transporter ATP-binding component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lrt  Lactobacillus reuteri I5007
Brite
KEGG Orthology (KO) [BR:lrt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lrt02000]
    LRI_0636
Transporters [BR:lrt02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    LRI_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 RsgA_GTPase AAA_29 dNK MMR_HSR1 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AGN98845
UniProt: R9WJS7
LinkDB All DBs
Position
645698..646561
Genome map
AA seq 287 aa AA seqDB search
MDQLIVKNIVKKYHRQTVLDNISFTLEPAKIYGLLGRNGAGKTTLLNIMSNRIFPTNGEV
QIGNEDVNNNDDLLSKIFLMSEVNLYPRHMKLSQTFDLADAAYNNFDYDLANRLLKVFGL
NDRMKITNLSTGQRTASKLIVALAVNAEYVLLDEPILGLDANHRDSFYKELVKTYQERPR
TFVLSTHLIEEIQQLVEHVLIMDQHHIIINEDTEGLLAKAYTISGPEKMVDEYTAGLKVL
KTEMMGNIKTAYLLDCLDEQRVIPDQVKIGHYDLQHLFIYLTNGGEY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggatcaattaatagttaaaaatattgtcaaaaagtatcatcgccaaacagtattggat
aatatttcatttaccctagaacctgctaaaatttatggtctccttggccggaatggggct
gggaagacgactcttcttaatattatgagcaaccggatttttccaacgaatggggaagta
caaattggtaatgaagatgttaataacaatgatgacctcctcagcaagatctttttgatg
agtgaagttaatctttatccgcgtcacatgaagctaagtcaaacctttgacttagcggat
gccgcttataataactttgactatgacttagccaaccgtctcctcaaggtattcggcttg
aatgaccggatgaagattactaacttatcgactgggcaacggacggcctccaagctaatc
gtcgccttagcagtcaatgccgagtatgttctattagatgaaccgattttaggtttagat
gctaatcaccgtgatagcttctataaagaattagttaagacttatcaagagcggccgcga
accttcgtcttatcaacccacttaattgaagaaattcaacaattagtcgaacatgttctc
atcatggatcaacaccacatcattattaatgaggatacagaaggtttattagccaaggct
tatacaattagtggtccggaaaaaatggttgatgagtatactgcaggcttaaaagtgctt
aaaacagagatgatgggtaatattaagactgcctacttacttgattgcttagatgaacag
cgtgtgattcctgatcaagtcaagattggccattacgatttgcagcatttattcatttac
ttaacgaatgggggagaatactaa

DBGET integrated database retrieval system