KEGG   Lactobacillus reuteri I5007: LRI_1467Help
Entry
LRI_1467          CDS       T02701                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lrt  Lactobacillus reuteri I5007
Pathway
lrt00240  Pyrimidine metabolism
lrt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LRI_1467
Enzymes [BR:lrt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LRI_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AGN99676
UniProt: R9WIE7
LinkDB All DBs
Position
complement(1501204..1501779)
Genome map
AA seq 191 aa AA seqDB search
MAQLFFKYGAMNSGKSIDILKVAHNYEEQGKPVVLMTSGVDDRSGRGIIASRIGLERKVK
PIMDDTNIYDYVNKMDRKIYCVLIDEAQFLKKEHVLQLIKIVDELNIPVMAFGLKNDFRN
ELFEGSKYLLIYADKIEEMKTICWFCPHKATMNLRIHNGKPVYEGEQVQIGGNESYYPVC
RKHYFHPQLKQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaactattctttaaatatggcgcgatgaattctggtaagtcaatcgatattttg
aaggttgctcataactatgaagaacaaggaaagccggttgtcttaatgacgagcggcgtt
gatgatcgttctggtcgagggatcattgctagtcgaattggcttagagcgtaaggtaaaa
ccaattatggatgacaccaatatttacgattacgttaataagatggaccgtaagatatat
tgtgtattgattgacgaagcacagtttttaaagaaagagcatgtcttacaattaatcaaa
attgttgatgagctaaatattccggtaatggcttttggactaaagaatgactttcggaat
gaattatttgaaggttcaaaatatttactgatttatgctgacaaaattgaagagatgaaa
acaatttgttggttctgtcctcacaaagctacgatgaatttacggattcataatggcaag
ccagtatatgagggagaacaagtccagatagggggaaatgaatcatattacccagtatgc
cggaagcactattttcatccccaattaaaacaatag

DBGET integrated database retrieval system