KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21670Help
Entry
HMPREF0538_21670  CDS       T01551                                 

Definition
(GenBank) Mur ligase middle domain protein
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
lru00550  Peptidoglycan biosynthesis
lru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lru00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0538_21670
Enzymes [BR:lru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     HMPREF0538_21670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M OrfB_Zn_ribbon DZR zinc_ribbon_10
Motif
Other DBs
NCBI-ProteinID: AEI57879
UniProt: F8DMD0
LinkDB All DBs
Position
complement(1693836..1695173)
Genome map
AA seq 445 aa AA seqDB search
MTVRSSFAEFAGRSSYWFLHTFMNGGSSLPGKLTLKLDPNILQAFSKKYDLVIVTGTNGK
TLTTALSVRVLREKYDQVLTNPTGSNMEQGIVTTFITAPCPKKKGLAVLEVDEANVVKVC
KYITPIAFVFTNIFRDQMDRYGEIYTTYYKILKGVKLAPKATIIANGDEQLFNSKDLPNP
IIYYGFNHEEKEPFNAPANTDGLLCPKCQHILKYRMRTYAGLGNYFCPNCGFHRPELTYA
VTKIDKLTPTHSTFEIDGQKYTIGIGGLYNIYNALAAYSLGRFLGVSQAQIKDAFESDER
VFGRQEVINIDGKQVTLILVKNPVGLNQVLDMIETDDKPFSFAFLLNANYADGIDTSWIW
DGDFEKLTQHQIPQYMTGGERYKDITTRLTMAGVKDMWHEPDLTQVIDKIKEMPTEHVYI
LATYTAVLQLRKQLAEKGYIKGGMD
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacagttcgaagttcatttgccgaatttgccgggcggtcaagctattggttcctccat
acttttatgaacggaggaagttcccttccaggaaaattaaccttaaagcttgatccaaat
attctccaagcctttagcaaaaagtacgaccttgttattgtaacagggacaaatggaaaa
acattaaccaccgcattaagcgtacgagttttacgggaaaagtatgaccaagttcttact
aatccgactggttccaacatggagcaaggaatcgtaactacctttattacggctccctgt
ccaaagaaaaaagggctggccgtcctcgaagtcgatgaagcaaatgtagttaaagtatgt
aaatacatcaccccaattgcctttgtcttcaccaacattttccgtgatcaaatggatcgt
tacggtgaaatctacaccacttattacaagatcttaaagggggttaaattagcaccaaaa
gcaaccatcatcgctaacggggatgaacagctctttaacagcaaagacttgcctaaccca
atcatctattatggctttaaccacgaagaaaaagagcctttcaacgccccagctaacact
gatggtctcctttgtcctaaatgtcaacacattctaaagtatcgaatgcgaacttatgcc
gggctaggtaactacttctgtccaaattgtggtttccatcgaccagaattaacgtatgct
gttaccaaaattgataagcttacccccacgcattcaacttttgaaattgatgggcaaaaa
tacaccatcggaatcggtggtttatataacatctataatgctcttgccgcttactctctt
ggtcgttttctcggagtgagccaagcacaaattaaagatgcttttgaatcagacgaacga
gtttttggccgccaagaagtcattaatatcgatggaaaacaagttactttgatcttagtt
aaaaatccagttggtcttaatcaggttttagatatgattgagacagatgacaagcccttt
agctttgccttcttactaaatgctaactatgctgatggaattgatactagctggatctgg
gacggcgactttgaaaaacttacccaacatcaaatcccacaatacatgacgggaggagaa
cggtataaagatattaccactagattaacaatggctggcgtaaaagatatgtggcatgaa
ccagaccttacccaggtaattgataaaatcaaggaaatgccaactgaacatgtctatatt
ctggcaacatatacagccgttctgcaattacgcaaacaactagcagaaaagggctatatt
aaaggaggaatggactaa

DBGET integrated database retrieval system