KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_00445Help
Entry
BJI69_00445       CDS       T04563                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Pathway
lrz00260  Glycine, serine and threonine metabolism
lrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BJI69_00445
Enzymes [BR:lrz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     BJI69_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C FAD_binding_3 ADH_zinc_N_2 Pyr_redox_2 Pyr_redox_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: APG06273
UniProt: A0A1L3EZ01
LinkDB All DBs
Position
82786..83808
Genome map
AA seq 340 aa AA seqDB search
MRALVKRKPEQGIWMEEVPVPQVGPNEVLIKVEKTAICGTDLHIYKWDEWSQRTITPGLT
IGHEFVGRVVDMGPGVTGYKIGDRVSAEGHIVCGHCRNCRAGRQHLCPNTVGIGVNRNGA
FAEYMTMPASNLWPIPDQIPSELAAFFDPYGNAAHCALEFDLIGEDVLITGAGPIGIIAA
GIAKHIGARNVVVTDVNDYRLKLAADMGATRVVNVANQSLKDVVKDLHIEGFDVGLEMSG
NPRAFGDMLDCMYHGGKIAMLGIMPRGAGIDWDKVIFKGLTLQGIYGRRMYETWYKMTQM
VLTGFPLQKVLTHQIAIDDFQKGFDLMDAGQCGKVVCSWT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgctggtcaagcgcaagcccgaacagggcatctggatggaagaagtgccggta
ccgcaagtcggcccgaacgaagtcctgatcaaggtcgagaaaaccgccatttgcggtacc
gacctgcacatctacaagtgggacgagtggtcccagcgcacgatcacgcccggcctgacc
atcggccacgagttcgtcggtcgcgtcgtcgacatgggccccggggtcaccggctacaag
atcggcgaccgcgtctcggcggaaggccatatcgtctgcggtcattgccgtaattgccgc
gccggtcgccagcacctgtgcccgaacaccgtcggcatcggcgtgaaccgtaacggtgcc
ttcgccgaatacatgacgatgcccgcctcgaacctctggccgatcccggaccagatcccg
tccgagctggccgccttcttcgacccgtacggcaatgccgcgcattgcgcgctggaattc
gacctcatcggtgaagacgtgctgatcaccggcgcgggcccgatcggtatcatcgccgcg
ggtatcgccaagcacatcggcgcacgcaacgtcgtggtaaccgacgtcaacgactatcgc
ctgaagctggccgccgacatgggtgccacgcgcgtggtcaacgtggcgaaccagtcgctc
aaggatgtggtcaaggatctgcacatcgaaggcttcgacgtcggcctggaaatgagcggc
aacccgcgcgcctttggcgacatgctcgactgcatgtaccacggcggcaagatcgccatg
ctcggcatcatgccgcgtggtgccggcatcgactgggacaaggtcatcttcaagggcctc
acgttgcagggcatctatggccgtcgcatgtacgagacctggtacaagatgacccagatg
gtgctgaccggctttccgttgcagaaggtgctcacgcatcagattgccatcgacgacttc
cagaagggcttcgacctgatggacgcaggtcagtgcggcaaggtcgtctgctcctggacc
tga

DBGET integrated database retrieval system