KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_02215Help
Entry
BJI69_02215       CDS       T04563                                 

Definition
(GenBank) 7,8-dihydro-8-oxoguanine triphosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lrz03400]
    BJI69_02215
Enzymes [BR:lrz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BJI69_02215
DNA repair and recombination proteins [BR:lrz03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BJI69_02215
 Prokaryotic Type
    BJI69_02215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: APG02838
UniProt: A0A0G9H7N4
LinkDB All DBs
Position
complement(464621..465109)
Genome map
AA seq 162 aa AA seqDB search
MPYTPIVATLGYVMSPDGQRVLMIHRNARQDDQHLGKYNGLGGKMEAGEDIAACMRREIM
EEAGIECLEMRLRGTLNWPGFGKQGEDWLGFIFVIDRYAGTPFESNAEGKLEWVPLAELD
ALPMWEGDRHFLPLVFDSDPRAFHGVMPYKDGRMVSWNVTRL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgccttatacgcccatcgtcgccacgctcggctacgtgatgtcgccggacggccagcgc
gtcctcatgatccaccgcaacgcccgccaggacgaccagcacctgggcaagtacaacggc
ctcggtggcaagatggaggccggggaggacatcgccgcctgcatgcgccgcgagatcatg
gaagaggcgggcatcgaatgcctggagatgcgtctgcgcggcacgctcaactggccgggt
ttcggcaagcaaggcgaagactggctcggcttcatttttgtcatcgaccgctatgcgggg
acgccgttcgagtccaacgcggagggtaagctggagtgggttccgttagccgagctcgac
gccctgcccatgtgggagggcgatcgccacttcctgccgctggtgttcgatagcgatccg
cgagcttttcacggcgtcatgccgtacaaggacgggcggatggtttcctggaacgtgacg
cggctgtag

DBGET integrated database retrieval system