KEGG   Luteibacter rhizovicinus: BJI69_10115Help
Entry
BJI69_10115       CDS       T04563                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lrz  Luteibacter rhizovicinus
Pathway
lrz00564  Glycerophospholipid metabolism
lrz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BJI69_10115
Enzymes [BR:lrz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BJI69_10115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 3HCDH_N Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: APG04215
UniProt: A0A0G9HAJ9
LinkDB All DBs
Position
2265801..2267312
Genome map
AA seq 503 aa AA seqDB search
MVEQVDVLVVGGGVNGVGIARDAVGRGLSVWLCERDDLASHTSSAATKLIHGGLRYLEQF
EFALVGKALAEREVLLRAAPHIIWPLRFILPHQPHLRPAWMIRIGLFLYDHLGRGRRTLP
GSRRVRFAKHVTGEPLRSEFHQGFVYSDAWVQDARLVVLNAMDAVHRGAKIETHTKCISA
RRDADGWTAELEARDGSRHFVKARALVNAAGPWAASFLDDVVHLKHSHTLRLIKGSHIVV
PKIFDHRYAYIFQQPDRRIVFAIPYERDFTLIGTTDIEYKADPSHPVIEAEETQYLCEAV
NRYFKKQLTPADVVWSYSGVRPLLQDESGSASEVTRDYLLDIDTDGAPLLNVFGGKLTTF
RKLSEEAVDKLAPLLGNDKPAWTADARPLPGGGERDIDALTDDIRSSRPWLPETFAWRLT
HMYGTRARDLLGEANGLAALGEHFGSDLYQAEVDYLVRHEWATEAEDILWRRSKIGLRVG
PDDVRRLTEYLNRRVPQGAATHP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagcaggtcgatgttctggtggtcggtggtggcgtcaatggcgtcggaatcgcg
cgtgatgcggtagggcgcggactgtcggtgtggctgtgcgagcgtgacgacctggcttcg
catacctcgagcgcggcgaccaagctgatccacggcgggctgcgctatctggagcagttc
gagttcgcccttgtcggcaaggcgttggccgagcgcgaggtcctgctcagggccgcaccg
cacatcatctggccgctgcgcttcattcttccgcaccagccgcacctgcgcccggcgtgg
atgatccgcatcgggctctttctttatgaccatctgggtcgcggccggcggacgctgccc
gggtcgcgccgcgtgcgttttgccaagcacgttaccggcgagccgctgcgcagcgaattc
caccagggcttcgtctactccgatgcctgggtgcaggatgcccgcctggtcgtgctcaac
gcgatggatgccgtgcaccgtggcgcgaagatcgagacgcacaccaagtgcatcagcgcg
cggcgtgatgcggatggctggacggccgagctcgaggcacgcgacggcagccgtcacttc
gtcaaggcgcgcgcgctggtcaatgccgccggcccctgggcggcgagcttcctcgacgac
gtggtccacctgaagcattcgcacacgctgcgcctgatcaagggcagccacatcgtggtg
ccgaagatcttcgatcatcgttacgcgtacatcttccagcagccggatcgccgcatcgtc
ttcgccattccgtatgagcgcgacttcacgctgatcggtacgacggacatcgaatacaaa
gcggatccctcgcacccggtgatcgaagcggaggagacccagtacctgtgcgaggcggtg
aaccgctacttcaagaagcagctcacgcccgccgatgtcgtgtggagctatagcggcgtg
cgtccgctgctgcaggacgaatccggcagcgcctcggaagtcacgcgcgattacctgctc
gatatcgatacggatggtgcgcccctgctcaacgtgttcggcggcaagctaaccaccttc
cgcaagctctccgaagaggccgtcgacaagctcgcgccgctgctgggcaacgacaaaccc
gcgtggacagccgacgcacgtccgctgcccggtggtggtgagcgcgatatcgacgcgctc
accgacgacatccgctcttcgcgtccgtggctgccggagacctttgcctggcggctcacg
cacatgtacggcacgcgcgcccgcgacctgctgggcgaggccaatggccttgccgcgctg
ggcgagcatttcggctcggatctgtaccaggcggaggtggattacctggtccgccacgaa
tgggcgaccgaagccgaggacatcctgtggcgccggagcaagatcgggctgcgtgtcggc
cccgacgatgtgcgtcgcctcaccgagtacctgaaccggcgtgtcccccagggggctgcc
acccacccgtag

DBGET integrated database retrieval system