KEGG   Luteibacter rhizovicinus: BJI69_15590Help
Entry
BJI69_15590       CDS       T04563                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
lrz  Luteibacter rhizovicinus
Pathway
lrz00500  Starch and sucrose metabolism
lrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BJI69_15590
Enzymes [BR:lrz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BJI69_15590
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BJI69_15590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: APG05181
UniProt: A0A0G9HF51
LinkDB All DBs
Position
3426524..3429841
Genome map
AA seq 1105 aa AA seqDB search
MATRAKAKKQAAAPDFSSDPLWYKDAIIYQVHLKSYFDSNDDGVGDFQGLIEKLDYIAEL
GVNTLWLLPFYPSPRRDDGYDIAEYKAVHEDYGKLADVKRFINEAHARGLRVITELVINH
TSDQHPWFQRARAAKAGSAARNFYVWSDTDQAYDGTRIIFLDTEKSNWTWDPVAGQYFWH
RFFSHQPDLNFDNPAVLKAVLDVMRFWLDMGVDGLRLDAVPYLIEREGTNNENLPETHDI
LKVMRAEIDQHYPDRMLLAEANQWPEDTQDYFGNGDECHMAFHFPLMPRMYMAIAREDRF
PITDIMRQTPAIPENCQWAIFLRNHDELTLEMVTDNERDYLWQTYAADKRARINLGIRRR
LAPLLERDRRRIELMNALLLSMPGTPVLYYGDEIGMGDNIHLGDRDGVRTPMQWSVDRNG
GFSRADPASLVLPPIMDPLYGFQAINVEAQSRDPHSLLNWTRRMLAVRKRYKAFGRGTLK
FLYPGNRKVLAYLREFDGEHVLCVANMSRSLQAVELDLAAFDGQVPIEIMGGSSFPPVGQ
LPYLLTVPAYGFYAFQICPNAQMPEWHEVPAEPMPDYETLVVRGALVEGPVMAHHRGVIE
KQVLPTYLGVRRWFAAKDRGIESVRILYAVPWPDRGDDLVFTEVEATLADGGKERYSLPV
GIVWEDESPTARAQQLTLARVRRGRRIGLLTDGFSLEAFASGLLIGLRNEVELPVSGGFV
RFERTDAFDADAFSSDVENRWMTTEQSNSSMILHDQGVLKLFRRTSAGINPEVEMGRFLT
ENGYANTSPLLGEVVRVDDQGDRTTIAVLQGFLRNQGDAWRWTLDFLRRSYDEYSHSNDE
ERRAEIEGGYDAFAAAVGTRLGELHALLAKPSEFPAFDPEKAPESAASSWRDSVRDQVKR
AIGSLDHATNVSDAIHAEIEAVHGLVATLDKHIGELAKAGKGALLTRTHGDFHLGQILVV
QDDAYIIDFEGEPARSLAERRGKHTPLRDVAGFLRSLHYAAAMARRGEDGLAPVEDEGFG
DYLARFRERSSKVFLEAYRSVLDAAPVRWVDAVALAPLLELFIIEKAAYEVSYEAANRPG
WLDVPLRGLLHAARGDTATELKEDS
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atggctacacgcgccaaagcaaagaaacaggcagccgctcccgatttctcgagcgatccg
ctctggtacaaggacgccatcatctatcaggtgcatctgaagtcgtacttcgactccaac
gatgacggtgtcggcgacttccagggtttgatcgagaagctcgactacatcgccgagctg
ggcgtgaacacactctggctgctgccgttctatccgagcccgcgccgcgacgatggctac
gacatcgccgaatacaaggccgtgcacgaagactacggcaagctcgccgatgtgaagcgc
ttcatcaacgaagcccatgcgcgcggcctgcgcgtgatcaccgagctggtcatcaaccat
acctccgaccagcacccgtggttccagcgcgcacgcgcggcgaaggcgggatcggcggcg
cgcaacttctacgtctggtcggatacggaccaggcctatgacggcacgcgcatcatcttt
ctcgataccgagaagtcgaactggacctgggatccggtcgccgggcagtacttctggcat
cgctttttctcgcaccagccggatctgaacttcgacaacccggctgttctgaaggccgtg
ctcgacgtcatgcgcttctggctcgacatgggcgtggacggcttgcgtctggatgccgtg
ccttacctgatcgagcgggaagggacgaacaacgagaacctccccgaaacgcacgacatc
ctcaaggtgatgcgcgccgagatcgaccagcactatcccgaccgcatgctcctggccgag
gccaaccagtggccggaagacacgcaggattatttcggcaatggcgacgaatgccacatg
gccttccattttccgttgatgccacgcatgtacatggcgatcgcgcgcgaagaccgcttt
ccgatcaccgacatcatgcggcaaacgccggcgattccggagaactgccagtgggcgatc
ttcctgcgcaaccacgacgagctcacgctcgaaatggtcacggataatgagcgcgactac
ctgtggcagacctacgccgcggacaagcgtgcgcgcatcaatctcggcatccgtcgtcgt
ctggcgcccctgctcgagcgcgaccgccgtcgtatcgagctgatgaatgccttgctgctg
tcgatgcccggcacgccggtgctctactacggcgacgagatcggcatgggcgacaacatc
catctcggcgatcgcgatggcgtgcgtacgccgatgcagtggtcggtcgaccgcaacggc
ggtttctcgcgggccgatccagccagcctcgtgctgccgccgatcatggatccgctctac
ggcttccaggcgatcaatgtcgaagcccagtcccgcgatccccattcgctgctgaactgg
acgcgccgcatgctcgccgtgcgcaagcgctacaaggccttcggtcgcggcacgctcaag
tttctctacccgggcaaccgcaaggtgctggcctatctgcgcgagttcgatggcgaacac
gtgctctgtgtggcgaacatgtcgcgctccctgcaggccgtggaactggatctcgccgcg
ttcgacggccaggtgccgatcgaaatcatgggtgggtcgtcgtttccacccgttgggcag
ctgccttacctgctgaccgtgccggcgtacggcttctacgccttccaaatctgcccgaac
gcgcagatgcccgagtggcacgaagtgcctgccgagccgatgcccgattacgagaccctg
gtggttcgcggcgccctggtcgaagggccggtgatggcgcatcaccgcggcgtcatcgaa
aagcaggtgttgccgacctacctcggcgtgcgccgctggttcgcggcgaaggatcgtggc
atcgagtcggtgcgaattctttacgcggtgccctggccggaccgtggcgacgacctcgta
ttcaccgaggtcgaagcgaccctggccgatggtggcaaggagcgttacagcttgccggtg
ggtatcgtctgggaagacgagagtcccacggcgcgtgcccagcagcttacgttggcccgt
gtgcgtcgcggccgtcgtatcggtctgctcacggacggcttctcgctcgaggcctttgct
tccgggctgctgatcggcttgcgtaacgaggtggaactgccggtcagcggtggtttcgtt
cgcttcgaacggaccgatgccttcgacgcggacgcgttctccagcgacgtcgaaaaccgc
tggatgaccaccgagcagtcgaacagctcgatgatcctccacgaccagggcgtgctgaaa
ctgttccgccgcacctcggcggggatcaatcctgaagtcgagatgggccgcttcctcacc
gagaacggctacgccaacacctcgccgctgctgggcgaagtggtgcgggtcgacgaccag
ggcgatcgcaccacgatcgccgtactgcagggtttcctgcgcaaccagggcgacgcgtgg
cgctggacgctggacttcctgcgtcgtagctacgacgagtacagccactccaacgacgaa
gagcgccgtgcggaaatcgaaggcggctacgacgccttcgccgccgccgtcggcacgcgt
ctcggcgaactgcacgcgctgctggcgaagccctcggagttcccggcgttcgatccggag
aaggcccccgaatccgcggccagttcatggcgtgacagtgttcgcgatcaggtgaagcgc
gccatcggttcgctcgaccatgccacgaacgtttccgacgccattcacgctgagatcgag
gctgtgcacgggctggttgccacgctggacaagcacatcggcgagctggcaaaggcgggc
aagggtgcgctcctgacccgtacccacggcgacttccacctcggccagatcctcgtcgtc
caggacgatgcgtacatcatcgacttcgaaggcgagccggccaggtcgctcgcggagcgt
cgtggcaaacacacgccgctgcgcgacgtcgccggtttcctgcgctcccttcactacgcc
gcggcgatggcccgtcgtggcgaggacggcctcgcaccggtggaagacgagggcttcggc
gattacctcgcacgcttccgcgaacgctcgtcgaaggtgttccttgaggcctaccggagc
gtgctggatgcggcccctgtgcgctgggtcgatgccgtggcgctcgcaccgctgctggag
ctcttcatcatcgaaaaggcggcctacgaggtcagctacgaggccgcgaaccggcccggc
tggctggacgtgccgctgcggggtctgctccatgcggcccgcggtgacaccgccactgaa
ctgaaggaggattcgtga

DBGET integrated database retrieval system