KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_16050Help
Entry
BJI69_16050       CDS       T04563                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Pathway
lrz00361  Chlorocyclohexane and chlorobenzene degradation
lrz00625  Chloroalkane and chloroalkene degradation
lrz01100  Metabolic pathways
lrz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJI69_16050
   00361 Chlorocyclohexane and chlorobenzene degradation
    BJI69_16050
Enzymes [BR:lrz01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BJI69_16050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PAS_4
Motif
Other DBs
NCBI-ProteinID: APG05263
UniProt: A0A0G9HJL1
LinkDB All DBs
Position
3530423..3531043
Genome map
AA seq 206 aa AA seqDB search
MHSKRNVVIFDFGGVLVDWNPRYLYSKLFGDDEAGMERFLAEVTTPEWNLQQDAGRSWEE
AVRLLSAEHPTQADLIAAYQHRWEETLGGPIDDSLHILRELKDAGHPLYGLTNWSHETFP
IARQRYAFFDCFDGIVVSGEEGMIKPNPKLYETLLERYDIDPTCAIFIDDNKVNVEAAEA
LGIHGIHFHTPAQLRAELIKLGFLPK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcattccaaacgcaatgtagtcatcttcgatttcggcggcgtgctcgtcgactggaat
ccccgctatctctacagcaagctgttcggcgacgacgaagccggcatggaacgcttcctc
gctgaagtgaccacgccggaatggaacctgcagcaggatgccggccggtcgtgggaggaa
gccgttcgtttgctgagcgccgagcatcccacccaggccgacctgatcgccgcttaccag
catcgttgggaagagacgcttggcggtcccatcgacgatagcctgcatatcctgcgcgag
ctcaaggacgcggggcatcccttgtatgggttgaccaactggtcgcacgagacctttccg
atcgcacgccagcgatatgccttcttcgattgcttcgatggcatcgtggtgtcgggcgag
gagggcatgatcaagccgaatccgaagctctacgaaaccctgctcgagcgctacgacatc
gatccgacgtgcgccatcttcatcgatgacaacaaggtcaatgtcgaggccgccgaagcc
ctcggaatccacggcattcattttcatacgccagcccaactgcgtgccgaactgatcaag
ctcgggttcctgcctaaatga

DBGET integrated database retrieval system