KEGG   Luteibacter rhizovicinus: BJI69_19425Help
Entry
BJI69_19425       CDS       T04563                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
lrz  Luteibacter rhizovicinus
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lrz01004]
    BJI69_19425
Enzymes [BR:lrz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     BJI69_19425
Lipid biosynthesis proteins [BR:lrz01004]
 Acyl-CoA synthetase
  Unknown
   BJI69_19425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2 AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: APG05860
UniProt: A0A1L3EXX6
LinkDB All DBs
Position
4278721..4280484
Genome map
AA seq 587 aa AA seqDB search
MSADGNIAIQVGLATPTMNTVPLRRADFASLAEVLDYAACGVTGANFYAGGKLDLALPYR
TLRKEALELAQRLATLGLERGARLAIVAETNADFLRFFFACQYVGLVPVALPSTVNLGGH
DAYVKKLRGMLQAAGASVAVASEGFIGFLGEAVAGLNIAKWGTPAAFAELPNHNVELQPL
GPTEVAYLQFTSGSTGTPKAAMITEQALMANLQGSNNHGLDLRDDDRFVSWLPFYHDMGL
VGCLLTVMAGQRSIDYLDTREFAMRPRRWLELMSSSKATIAYSPPFGYEMCARRVRPGDI
ASYDLSHWRVAGIGAEPILPEVPARFAELLAPAGFDARAFVPSYGMAEASLAISFSPLQA
GIVVEWIDPTHLAEDLIATPVAAGTGTGFVRCGGPLPGHELEIWNDAGTQLADLHVGRIM
VRGPSIMSGYYQQPEKTAEVLAADGWLDTGDIGYVVDGEVVVTGRHKDMIIVNGRNIWPQ
DIERIVERQPELRSQDASAFGVPGPGGAEVAAVVVQCNTDDVEVRESLINRIRGDLLEEL
GIACLIELVPRHTLPRTSSGKLSRSATRSGYLERQAQEQAPQAAAAA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagacggaaacattgccatccaggtcgggctagccacgcccaccatgaacacg
gtgcccctgcgccgtgcggactttgccagccttgcagaagtgctggactacgccgcatgt
ggcgtcacgggtgccaacttctacgcgggcggcaagcttgatctggccctgccctaccgg
acccttcgtaaagaagcccttgagctggcgcagcgactcgcgacgctcgggctcgagcgc
ggtgcccgtctggccatcgtggctgaaacgaacgccgacttcctgcgtttcttctttgcc
tgccagtacgtcggcctcgttcccgtggcccttccgtcgacagtgaatctcggcggccat
gatgcgtacgtgaagaagcttcgcggcatgctccaggccgctggtgcctcggtggccgtc
gcttcggaaggcttcatcggcttcctcggcgaagccgtcgctggcttgaatatcgccaag
tggggcacgcctgccgcgttcgcggagctgccgaaccacaacgtcgaactgcagccgctc
ggcccgaccgaagtcgcctacctccagttcacctcgggcagcaccggtacgccgaaggcg
gcgatgatcaccgagcaggcgctgatggcgaacctgcagggttcgaacaatcacggtctc
gacctgcgtgatgacgaccgtttcgtctcctggctcccgttctatcacgacatgggcctg
gtcggctgtctgctgaccgtcatggcgggccagcgctcgatcgactatctggacacgcgc
gagttcgcgatgcgtccgcgtcgctggctcgagctgatgagctcgtcgaaggccacgatc
gcctacagcccgccgttcggttacgagatgtgcgcacgtcgcgtccgtccgggcgacatc
gcttcgtacgacctgtcgcactggcgcgttgccggtatcggcgccgagccgatcctgccg
gaagtcccggcgcgctttgccgaactgctggcgccggctggtttcgacgcacgcgcgttc
gtgccgtcctacggcatggccgaagcgtcgctggcgatcagcttctcaccgctgcaggcg
ggcatcgtcgtcgaatggatcgatccgacccatctcgccgaagacctcatcgcgacgccg
gtcgctgccggcaccggtacgggtttcgtccgttgcggcggcccgctgccgggccacgag
ctcgagatctggaacgacgccggcacgcagctggccgacctccacgtcggtcgcatcatg
gtgcgtggtccgagcatcatgtcgggctactaccagcagccggaaaagaccgctgaagta
ctggccgccgatggctggctcgacaccggcgatatcggttatgtcgtcgatggcgaggtc
gtcgtcaccggccgtcacaaggacatgatcatcgtcaacggccgcaacatctggccgcag
gacatcgagcgcatcgtcgagcgtcagccggaactgcgttcgcaggacgcctccgcgttc
ggcgtgccgggcccgggcggcgccgaagtcgccgccgtggtcgtccagtgcaacaccgac
gacgtcgaggtccgcgagtcgctgatcaaccgtatccgtggcgacctcctggaagagctc
ggcattgcctgcctcatcgagctggtgccgcgtcacaccctgccgcgtacgtcgtcgggc
aagctgtcccgctcggccacccgcagcggttacctggagcgtcaggctcaggaacaggct
ccgcaggccgccgccgcggcatga

DBGET integrated database retrieval system