KEGG   Lactobacillus sakei: LCA_0100Help
Entry
LCA_0100          CDS       T00299                                 

Gene name
gpm1
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsa  Lactobacillus sakei
Pathway
lsa00010  Glycolysis / Gluconeogenesis
lsa00260  Glycine, serine and threonine metabolism
lsa00680  Methane metabolism
lsa01100  Metabolic pathways
lsa01110  Biosynthesis of secondary metabolites
lsa01120  Microbial metabolism in diverse environments
lsa01130  Biosynthesis of antibiotics
lsa01200  Carbon metabolism
lsa01230  Biosynthesis of amino acids
Module
lsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lsa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCA_0100 (gpm1)
  09102 Energy metabolism
   00680 Methane metabolism
    LCA_0100 (gpm1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCA_0100 (gpm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsa04131]
    LCA_0100 (gpm1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsa04147]
    LCA_0100 (gpm1)
Enzymes [BR:lsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCA_0100 (gpm1)
Membrane trafficking [BR:lsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LCA_0100 (gpm1)
Exosome [BR:lsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCA_0100 (gpm1)
  Exosomal proteins of melanoma cells
   LCA_0100 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAI54399
UniProt: Q38ZH8
LinkDB All DBs
Position
96789..97496
Genome map
AA seq 235 aa AA seqDB search
MANLVIVRHGESVANQLKTYTGWSDVALTAKGRQQAHQVGRQIKDAGFQFSHVHTSLLKR
AILTSYIVLEELDQLALPMTKSWRLNERHYGALRGLNKDTTRTIFGVHQVARWRRSYTAL
PPLLIRSSTARRYRLVPRKSRPRGESLAQATQRLLPYWQDQVVPGLLAGQDQLIVAHGST
LRALIKVIEQISDQAIDGVEVANGEALYYQFGTDLTVLKKGRLALGSETDEEKEN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttagtaattgttagacacggcgaaagtgtcgccaatcaactgaagacctat
accggttggtcagatgtggcactcaccgctaaagggcgacagcaagcccatcaagttggc
cggcagataaaagacgctggctttcaatttagccacgtgcacacgtctttattgaaacgg
gcaattttgaccagttacattgttttagaagaactcgatcaattggcgctaccaatgact
aagagttggcgcttgaatgaacgacactacggtgctttgcgtggcttgaacaaagacacg
acgagaaccatttttggtgtccaccaagtagcgcgctggcggcgcagttatacagcgctg
ccaccacttttaattcggtcatcaactgcgcgtcgctatcgcttagtgccacgtaagagt
cgaccacgcggcgaaagtttggcgcaagccacccaacgtttattaccttattggcaagat
caagtggtgccggggttacttgctgggcaagatcagctaattgttgcgcatggctcgact
ttgcgtgccttaattaaggttatcgaacaaatttcagatcaggccattgatggcgtggaa
gtcgcaaacggtgaagcgctttattatcaatttggcacagatttaacagtactcaagaag
ggaagactagcactaggtagtgaaacggatgaagagaaagaaaattaa

DBGET integrated database retrieval system