KEGG   Lactobacillus sakei: LCA_0692Help
Entry
LCA_0692          CDS       T00299                                 

Definition
(GenBank) Putative serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lsa  Lactobacillus sakei
Brite
KEGG Orthology (KO) [BR:lsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsa01001]
    LCA_0692
Enzymes [BR:lsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LCA_0692
Protein kinases [BR:lsa01001]
 Serine/threonine kinases: Other
  Bacterial family
   LCA_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo Haspin_kinase RIO1 Seadorna_VP7 Pox_ser-thr_kin PBP1_TM PIP49_C RcpC
Motif
Other DBs
NCBI-ProteinID: CAI54996
UniProt: Q38XT3
LinkDB All DBs
Position
689929..691812
Genome map
AA seq 627 aa AA seqDB search
MMETGYAVAGRYKIIRPIGEGGMANVYLAQDLILDRQVAVKVLRLDLRNDPSTVRRFTRE
ALATTELNHPNIVSIYDVGEENSMQYIIMEYIKGTDLKKYIVEHFPIPYQRVIDIMTQIL
SAVQNAHAHNIIHRDLKPQNILVDEDGNIKISDFGIAIALSETAMTQTNTLLGSVHYLSP
EQARGSMATKRSDIYSLGIVLYELLTGMVPFEGESAVSIAIKHFQDEVPPVRNYDPRIPQ
ALENVVLKATAKDPDERYSGVDAMMADLATSLSASRAHEPKFVPSKADDLSETKVIPALD
PEGITQTNNDEEQVKEAESTQKKVKKPAKSKRKWWLLGGGVVLLLLLATVIAFAVQGSEV
TVPDLTDMTQQNAESALTDKKLKVGTVQKTTSQKYSKGHVIRTTPKAGLSVKSKSTVNLI
VSSGRQKYKIKDYTNQAYSDVRDALKDKGLKVKRKYQSSSEVSPGLIIDQSIAAGKRVVP
SKTTITLTVSSGKPGFALHNLSNYTKQGIQDYAAQNGLTVVFSEEYSSSISEGMVISQSP
ASGTMVQEGDSVSVILSKGEQPTEHHSIVTSSSNSVIESSAPESSQSSESSASESESESE
SESESESASESISSSASQSSQSSVQSK
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaacagggtacgctgtagcggggcgttataagattattcggcccattggtgaa
ggcggcatggctaatgtttatttggcgcaggatctaattttagaccggcaagtggcagtt
aaagttttacgattagatctccgaaatgatccgagtacagtccgacggtttacgcgagaa
gcgttggcaacgactgaattaaatcatccgaatattgttagtatttacgatgttggtgaa
gaaaacagtatgcagtacatcattatggaatatattaagggcaccgatcttaagaaatat
atcgtggaacactttccaattccttatcaacgtgtaattgatattatgacgcagatttta
tctgcggttcaaaacgcacatgcgcataatattattcatcgggatttaaaaccacaaaat
attttggttgatgaagacggcaatattaagattagtgactttgggattgcgattgcgctc
agcgaaacagcgatgactcagaccaacacgttgttggggtctgtgcattatctctcaccg
gaacaggcaagaggctcgatggcgacgaaacggtctgatatttactcgttaggaattgtg
ctttatgagttattgacggggatggtgccttttgaaggcgagtccgctgtttcaattgcg
attaagcatttccaagatgaagtcccaccagtacgcaactatgatccacgtattccgcaa
gccctggaaaatgtcgttttaaaagcgactgccaaggatccggatgaacgctatagtggt
gttgatgccatgatggctgacttagcaacttctttatcagctagtcgtgcgcacgaacct
aaatttgtgccatcaaaagcggatgatttgagtgagactaaggtgattcctgcactagat
ccagaaggcattacgcaaaccaacaacgatgaggaacaagttaaagaagcagaatcaact
cagaaaaaggttaaaaagccagctaagtctaagcgtaagtggtggctactaggtggcggt
gttgttttattgctgttattagcaacggtgattgcttttgcagttcaggggagcgaagta
accgtccctgatttaacggatatgacacaacaaaatgcggaatctgctttgaccgataaa
aaactgaaagtcggcacggttcaaaaaacaacgagtcagaaatacagtaagggccacgtc
attcgaacaacacctaaagcgggcctgagtgtaaaatcaaaaagtacggttaatttaatt
gtcagttcaggacgccaaaagtataagattaaagactatacgaaccaagcatatagtgat
gttcgggatgctttgaaggataaaggcttgaaagttaaacggaaataccaaagttcatct
gaagtgagtcctgggttgattatcgatcaaagtattgcggctggcaaaagggtcgttcca
agtaaaacgacgattaccttaacagtcagcagcggcaaacctggttttgcattgcataat
ctaagcaactatacaaagcaagggattcaagactatgctgcacaaaatggtttaacggtc
gtattctctgaagaatattcatcaagtatttctgaaggaatggtaatcagtcaatcgcct
gcaagtggtacaatggttcaagaaggtgatagcgtaagcgttatcctttcaaaaggcgag
caaccaactgaacatcattctattgtgacgtcgagttcaaattcagttatcgagtcgagt
gcgcctgaatcaagtcaatcgagtgaaagtagcgcgagtgagtcagagagcgaatcagag
agtgaatcggaaagcgaatcagcaagtgaatcgatcagtagttcagctagtcaaagtagt
caatcgagcgttcaatcaaagtaa

DBGET integrated database retrieval system