KEGG   Lactobacillus sakei: LCA_1572
Entry
LCA_1572          CDS       T00299                                 

Definition
(GenBank) Putative teichoic acid/polysaccharide glycosyl transferase, family 2
Organism
lsa  Lactobacillus sakei
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_trans_2_3 TIR-like Glyco_transf_7C
Other DBs
NCBI-ProteinID: CAI55879
UniProt: Q38VA4
LinkDB
Position
complement(1546380..1547333)
AA seq 317 aa
METPLISIVMAVYNEKETELRQSIESILKQSYQNFEFIIVLDNPDNQALAAVLNEYAKEE
PRIVLISNEHNLGLAPSLNRGLKASRGDYIARMDADDIAVPERLMTEFDLLQQRQLDVIA
SSSILIDETNAEIGRHPQMVESAAAVRELLQYDNFIVHPSVLGKKAAFETVGGYQEQLIA
CEDYDLWLRMIAAGQQIGVTNEPLMRYRIRQNSMTQSDMLKTFLISGFLRQTTVFRLTAS
DEAIKAKLEAYLTEKGFYDQHQKDRFNANINLLSTVKKTKSIGKGLQFLGILLSDGNVRR
YYLEKIQYSRTLKRLSK
NT seq 954 nt   +upstreamnt  +downstreamnt
atggaaacaccgttaattagtattgtgatggccgtttataatgaaaaagaaacggaatta
cgccagtcaattgaatcaattctgaaacagtcttatcaaaattttgagttcatcattgtt
ttggataatcctgataatcaagcattggcagctgttttaaatgaatatgcaaaagaagaa
ccgcgaattgttttaatcagcaacgagcataatctagggttagcacctagtttgaatcgg
ggattgaaagcaagtcggggtgattacattgcgcgaatggatgctgatgatattgctgtg
ccagaacggctaatgactgaatttgatttattgcaacaacggcaattggatgttattgca
tcatcttcgattctgattgatgaaactaatgccgagattggtcggcatccacaaatggtt
gaatcagcagctgccgttcgtgagttattacaatatgataatttcattgttcatccgagt
gttctgggtaaaaaagcagcttttgaaacagttggtggctatcaggaacaactaatcgcc
tgtgaagattatgatttgtggttacgaatgatcgcggcgggtcagcaaataggtgtgact
aatgaaccgttgatgcgttatcggattagacaaaacagtatgactcaaagtgacatgtta
aaaacctttctaatttctggctttttacgtcagacgactgtgtttagattaacagcgagt
gatgaagcaatcaaagcgaaactggaagcttacctaactgaaaaagggttttacgatcaa
catcaaaaagaccgctttaacgctaatattaatttattgagcactgttaaaaaaacgaaa
tcaattggtaagggactccagtttctgggcatcttgctgagtgacggtaatgtgagacgg
tactatttagaaaaaattcagtacagccgaacattaaaacgattatcaaaataa

DBGET integrated database retrieval system