KEGG   Litorilituus sediminis: EMK97_00100Help
Entry
EMK97_00100       CDS       T05852                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lsd  Litorilituus sediminis
Brite
Enzymes [BR:lsd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EMK97_00100 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: QBG34254
LinkDB All DBs
Position
complement(24195..24776)
Genome map
AA seq 193 aa AA seqDB search
MSIELPSLPYEQDALEPHISAETLSFHYGKHHNTYVVKLNGLIEGTEFAGKSLEDIVKTS
SGGVFNNAAQIWNHTFYWHSLSPTGGGEPTGDLLAAINASFGSFDEFKAKFTDSAINNFG
SSWTWLVKNQDGSLAIVNTSNAATPLTDEGVTPLLTVDLWEHAYYIDYRNVRPDYLNGFW
QLANWDFAAENFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcgaactaccatcattaccatacgaacaagatgcgctagagccacatatttct
gctgaaactttatcgtttcactatggtaaacatcacaacacctatgttgttaaattaaac
ggcttaattgaaggtactgaatttgcaggtaaaagcttagaagacatagttaaaacatca
tctggtggtgtgtttaacaacgcagcacaaatttggaatcacaccttctattggcacagc
ttaagccctacaggtggtggcgaaccaacaggtgatttacttgctgccattaacgcaagt
tttggtagctttgatgaatttaaagctaaatttaccgacagcgccattaacaactttggc
tcaagctggacttggttagttaaaaaccaagacggcagccttgctattgttaatacttca
aatgctgctaccccattaactgacgagggtgtaacaccactattaacggtagatttatgg
gagcatgcttattacattgactatcgcaatgtacgccctgattacttaaatggtttctgg
caattggcaaactgggattttgccgcagaaaactttgcctaa

DBGET integrated database retrieval system