KEGG   Litorilituus sediminis: EMK97_01060Help
Entry
EMK97_01060       CDS       T05852                                 

Definition
(GenBank) penicillin binding protein PBP4B
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EMK97_01060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lsd01002]
    EMK97_01060
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lsd01011]
    EMK97_01060
Enzymes [BR:lsd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EMK97_01060
Peptidases and inhibitors [BR:lsd01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   EMK97_01060
Peptidoglycan biosynthesis and degradation proteins [BR:lsd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EMK97_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Amidase_2 PG_binding_1
Motif
Other DBs
NCBI-ProteinID: QBG34424
UniProt: A0A4P6P0R8
LinkDB All DBs
Position
239094..241541
Genome map
AA seq 815 aa AA seqDB search
MATKHISRLLVKFVVGLMVLTQSACSQLTIEQQLSDNYNQRIKFLVLHYTAGDYQESMQA
LTTQGHASAHYLIPALNDASYPENSLKVVQLVEEQHRAWHAGRSYWQGKESINDQSIGIE
LVNLANCQKREQEYGYSQQKICFYPDYQAEQISLLITLIKDILANNPDIKPTAIVGHSDI
APNRKTDPGPRFPWHQLYQAGIGAWYEQETVAKYWQRFNDKPPSVALIQQALLSYGYKIQ
VTGHYDAQTRAVIHAFQQHFIPWQISQRPDVKTAAVIFALLDKYFHQQLTHLLKLYEQAP
ATDVEGNKPVKKGQLSEVFPQREPSSRKLVNDRASFKGYAKRGEIIIDNVNANSADIFIN
GEKLLIAQPMNQHSRYRYSLKRRSQDGVNTVKVENVLPKGSEIRVTIPYPALKKADISKR
YDFAMVDKLIQDDVANGFPGAVLMVVKDGEIIKHSAYGFNRKYHDSGEPLTRGVEMSPDT
LFDLASNTKMFATNFALMKLISQGKLDINQAISHYLPEYVGEGRRYRTIKDMLSHRAGYA
AQVKFHRKDNRLGEEFYSQDKELTEHLILTQVPFIAPRQSKRIYSDTDYMLLGLLVERIT
GMALDTYVETEIYQPLALENIAFNPLKKGWHKNQFAATEIHGNTRDGRVEFEQVRDYVLQ
GEVHDENAYHSFAGVAGHAGLFADAESLAVLAQVLLNQGGYNEVELFSPQVLAEFTKADD
SNAAFALGWQRANQGENRWHFGPYASASAYGHTGWTGTATVIDPTHDLAIILLTNVRHSP
IKGKGCHYQFEGKQFETGKYGSIISLVYEAVLKVN
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaagcatatttctcgtttgctagttaagtttgtcgtgggcttaatggtgtta
actcaaagcgcttgtagccaacttaccatagagcagcaactgtctgataattacaatcag
cggatcaaatttttggtgctgcactacaccgctggtgattatcaagagtcgatgcaagcg
ttaacaacgcaagggcatgctagcgctcattatcttattcctgcgcttaatgatgctagc
tatcctgaaaactccttaaaggttgtgcaattagtagaggagcagcatagagcttggcat
gctggtcgcagttattggcaaggtaaagaaagcattaatgatcaaagtattggcattgag
ttggtaaaccttgccaattgtcaaaagcgcgaacaagagtatggttattcacaacagaaa
atatgtttttatcctgattaccaagcagagcaaatatcattattaattactttgattaaa
gatattttagcaaacaaccctgatatcaaacctactgcgattgttggtcacagtgatatt
gcgccaaaccgtaaaaccgatcccggccctaggtttccttggcatcaattatatcaagca
ggtattggtgcttggtatgaacaagagacggtagctaagtattggcaacgctttaatgac
aagcctcctagtgttgccttaatccagcaagcgctacttagctatggttataaaatacaa
gtgacaggacattatgatgctcaaacacgggcagttattcatgcatttcagcaacacttt
attccatggcagataagccaacgtccagatgttaaaacggcagcagtcatttttgctctg
ttagacaagtactttcatcaacaattaacgcatttgctaaaactgtatgagcaagcccca
gcgaccgatgtagagggtaataagccagtaaaaaaagggcagctaagcgaagtctttcca
cagcgagaacctagttcacgcaagctggtaaatgatagagcaagctttaagggctatgct
aaacgtggcgaaataatcattgataatgtcaatgccaattcagcagatatcttcatcaat
ggtgaaaagcttttaatagcacaacccatgaatcaacatagccgttatcgctatagctta
aaacgtcgtagccaagatggtgttaatacggttaaagttgaaaatgttttacctaaaggc
agtgaaatacgcgtaaccatcccttatccagcccttaaaaaggctgatatcagcaagcgc
tatgactttgctatggttgataaacttattcaagacgatgtcgctaatggtttccccgga
gcggtattgatggtagtaaaagatggggaaattataaagcacagtgcttatggctttaat
cgcaaataccatgattcgggagagccattaactcgtggtgttgaaatgagtcctgatacc
ttatttgaccttgcttctaataccaaaatgtttgctactaactttgctttaatgaaatta
atctcgcaaggcaagctcgatataaatcaagctattagccactatttacctgagtatgtc
ggtgaaggaaggcgttatcgcactattaaagatatgctcagccacagggctggctatgca
gcacaagttaaatttcatcgtaaagataatcgattaggtgaggagttttactcccaagat
aaagagctcactgaacacttaattttaacgcaagtacctttcattgcgcctaggcagtca
aaacgcatctatagtgatactgactatatgctattgggcttgcttgttgagcgtattacc
ggtatggcattagacacttatgtagaaactgaaatctatcagccacttgcattagaaaat
attgcttttaatccgctgaaaaaaggttggcataaaaaccaatttgccgcgacagaaata
catggcaatactcgcgatggccgtgttgaatttgagcaagtgcgagattatgttctacaa
ggtgaagtgcatgatgaaaatgcttaccactcatttgcgggtgttgcagggcatgcaggt
ttattcgcggatgcagaaagcttagcggtacttgctcaggtactgttaaaccaaggcggt
tataacgaggttgaactattttcaccacaagtattggcagaatttaccaaagctgatgat
agcaatgccgcctttgcgctaggttggcagcgagccaatcaaggggaaaatcgctggcat
ttcggcccttatgccagtgcaagcgcttatgggcacacaggctggacgggaaccgcaact
gtgatagatcccacacatgatttagcgattattttactaacaaacgtcagacacagccct
attaaaggcaagggttgccattaccaatttgaaggtaagcaatttgaaacgggaaaatac
ggcagcataatttctttggtctatgaggctgttttaaaagtgaattaa

DBGET integrated database retrieval system