KEGG   Litorilituus sediminis: EMK97_04965Help
Entry
EMK97_04965       CDS       T05852                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00550  Peptidoglycan biosynthesis
lsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EMK97_04965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lsd01002]
    EMK97_04965
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lsd01011]
    EMK97_04965
Enzymes [BR:lsd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EMK97_04965
Peptidases [BR:lsd01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EMK97_04965
Peptidoglycan biosynthesis and degradation proteins [BR:lsd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EMK97_04965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 CytoC_RC
Motif
Other DBs
NCBI-ProteinID: QBG37716
LinkDB All DBs
Position
1101366..1102520
Genome map
AA seq 384 aa AA seqDB search
MASYVGGFFFCASVALSPIAKAASIIPDAPQINAKGFILVDYTTGKVIAEGNADSQLAPA
SLTKMMTSYIIGKEIESGNISNTDKVTISENAWAKNFPDSSKMFIEVGTEVSVDELNRGI
IIASGNDACVAMAEHIAGSESAFADLMNAHAEQLGMSSSYFENSHGLDSSEHMTTPRDMA
TLASAIIREVPEEYALYKIKSFTYNNIKQYNRNSLLWDKSLNVDGMKTGHTSNAGYSLVT
SATKGNMRLVTVVMGTESERARKVESKKLLNYGFRFFETYNPYKAGEKFVSNRVWMGDKK
NVDLGILTDTPITIPRGQRKNLKANFELNQQLTAPIAKGTVVGKLFLQLDGEDIAQYPLV
TLQEVNEGSMFSRLVDYVKLQFVD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctatgttggcggtttcttcttctgtgcttcagtagcactttctcctattgct
aaagccgcatcaattattcctgatgccccacaaattaacgcgaaaggttttattctcgtt
gactacaccacaggtaaagttatcgctgaaggcaatgctgatagccaattagcaccagct
agcttaaccaaaatgatgaccagctacattatcggtaaagaaatcgaaagtggtaatatt
agcaatactgacaaagtcaccattagcgaaaatgcttgggcgaaaaacttcccagactca
tcaaagatgtttattgaagttggcacagaagttagcgtagatgaattaaatcgcggtatt
attatcgcctcgggtaatgatgcctgtgttgctatggcagagcatattgctggtagtgaa
agtgcttttgctgatttaatgaatgctcatgcagagcagcttggcatgtcaagcagttac
tttgaaaatagtcatggccttgacagctctgagcatatgaccaccccgcgtgacatggcc
actttagcgagtgctattattcgtgaagtccctgaagaatacgccctctataaaattaaa
tcatttacctacaacaatattaagcagtacaaccgtaatagtttgttatgggataagagc
ctgaatgtcgatggcatgaaaacgggccatacctcgaatgccggttatagcttagtaacc
tcagcaactaaaggaaatatgcgtttagttacggttgttatgggcactgaaagcgagcgt
gcaagaaaagtagagagtaaaaaattacttaactacggtttccgcttttttgaaacatat
aacccatacaaagccggtgaaaaatttgtttcaaatcgcgtatggatgggcgataaaaag
aacgttgatttaggcattttaacggatacgccaattaccattcctcgtggacaacgtaag
aatttaaaagcaaactttgagctaaaccagcaattaaccgcgcctattgctaaaggtact
gtagtaggtaagttattcttacaactagatggtgaagatatcgcccaatatccactagtc
accctgcaagaagttaatgaaggcagtatgtttagccgtttagtggattatgtaaaacta
caatttgtagattaa

DBGET integrated database retrieval system