KEGG   Litorilituus sediminis: EMK97_05235Help
Entry
EMK97_05235       CDS       T05852                                 

Gene name
rpiA
Definition
(GenBank) ribose-5-phosphate isomerase RpiA
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00030  Pentose phosphate pathway
lsd01100  Metabolic pathways
lsd01110  Biosynthesis of secondary metabolites
lsd01120  Microbial metabolism in diverse environments
lsd01130  Biosynthesis of antibiotics
lsd01200  Carbon metabolism
lsd01230  Biosynthesis of amino acids
Module
lsd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lsd_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EMK97_05235 (rpiA)
Enzymes [BR:lsd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     EMK97_05235 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC RNase_PH_C
Motif
Other DBs
NCBI-ProteinID: QBG35162
LinkDB All DBs
Position
1163616..1164281
Genome map
AA seq 221 aa AA seqDB search
MTQDEMKKASAIKALEFIEKDTVVGVGTGSTVNHFIDALATIKHDITGAVSSSEESTKRL
KAHGIEVFDLNSIDTLDVYVDGADEITQHMSMIKGGGAALTREKIVAAVAKKFICIADDS
KQVDILGQFPLPVEVIPMARSYVARELVKLGGDPVYRQGVVTDNGNVILDVHNLSITDPK
KLETQINAIVGVVTNGLFAQRGANILVLGTKDGVQVIGENE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagatgaaatgaaaaaagcctctgctatcaaagcactagaatttattgaaaaa
gacactgtagtcggtgtgggtacaggctctacggtcaatcactttattgatgctttagct
acaataaagcatgatattaccggtgcagtttcaagctcagaagaatcaacaaaacgcctt
aaagcccacggtatagaagtgttcgatctaaatagcatagacacacttgatgtttacgtt
gatggcgccgacgaaattactcagcatatgagcatgattaaaggtggtggtgctgcccta
acccgagaaaaaattgtagccgctgtcgctaaaaaattcatctgtattgctgatgattca
aagcaagtggatattttaggacagtttccactccctgtagaagtaattcctatggcgcga
agctatgttgctcgtgagctggtaaaacttggcggagatcctgtttatcgtcaaggtgtt
gtgactgataatggcaatgttattcttgatgttcataacctttcaattactgatcctaaa
aaattagaaactcaaatcaatgccattgtaggtgtagttacaaatggcttatttgctcag
cgcggcgccaacatcttagttttaggtacaaaagatggtgttcaagtcattggtgaaaat
gaataa

DBGET integrated database retrieval system