KEGG   Litorilituus sediminis: EMK97_06515Help
Entry
EMK97_06515       CDS       T05852                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00564  Glycerophospholipid metabolism
lsd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EMK97_06515
Enzymes [BR:lsd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EMK97_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 Lycopene_cycl AlaDh_PNT_C CBM_6 GIDA
Motif
Other DBs
NCBI-ProteinID: QBG35396
UniProt: A0A4P6P202
LinkDB All DBs
Position
complement(1455724..1457445)
Genome map
AA seq 573 aa AA seqDB search
MTMQTAGVDISNDYTALHQDNVSRLDSNASCDLPGKLSQTRQQRIAEIAAQPHWDLVVIG
GGITGAGVLKLASQMGLKVLLLEQKDFAWGSSSRSSKMVHGGLRYMAQGQLALTRESVVE
RQRLVAQGQPLVTKHSFVMSHYQRAFPSPWLFNKLLACYDLIAGVNQHKFWPKASYLALA
PHIDENKLLGGTQFFDALTDDARLVLRLIQESLHLGAQVLNYAQVTAIASKANAKQVSLT
IDGQAVTVNASVVVNATGAWSNQVKASCTDLDTKAKKTAHMRPLRGSHLVLPSWRLPVAS
VIAIRHGDDNRPVQVYPWQNVTIVGTTDVEHLSPLSEEASISQAEFDYLLKAVAQQFPDA
NINASDVISTFSGVRPVTTSAKNAPPSKEKRQHQINNHDGVISVTGGKLTTFRLIAEQVL
QQAAQYIAVADFHHKLQAVNQYAIFSPANCQSERLLPAQVEQHILACYGSLSQHFIKLSD
AQQLLPIRYSKHVWAELIWAVQYEQVQHLDDLLLRRTRLGNVLPKGGIDLLPKIQALCAP
YMPWSDTDWQQEIARYMQLWRKYYRVPECGDSK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgactatgcaaacagcaggcgttgatatttcaaatgactacacggcattacaccaagat
aatgtctctaggcttgatagtaacgccagttgtgacttgcctggtaagttgagccagact
cgtcagcaacgcattgcagaaatagcagctcaaccccattgggacttagttgttattggt
ggcggtattactggtgctggggtgttaaagcttgccagccaaatgggcttaaaagtcctg
ttactagagcaaaaagattttgcttggggtagctcgagtcgttcgtcaaaaatggtgcac
ggcggcttgcgttatatggcgcaagggcagctggcattaacgcgagaatctgttgttgag
cgtcagcgtttagtcgcacaaggacaaccgctggtaactaaacacagttttgtgatgagt
cattatcagcgcgcttttccaagtccttggctgtttaataaattattggcttgttatgac
ttgattgctggcgttaaccagcacaagttttggccgaaagcatcatatttagcattagcg
ccacatattgatgaaaataagctactcggtggtacgcaattttttgatgccttaaccgat
gatgccagattagtattacgcttaattcaagagtcattacacttgggcgctcaagtgctt
aattatgcacaagtcaccgcgattgcaagtaaggcgaatgctaagcaagtttcgctaact
attgatggtcaagccgtaacggttaatgcttctgtggtggttaatgcaactggggcatgg
tcgaatcaagtcaaagcaagttgcacagatcttgatactaaggctaaaaaaacagcgcat
atgaggccattaaggggcagtcatttggtgctgcctagctggcgtttacctgttgccagt
gtgattgccattcgtcatggtgatgataacaggccagtgcaggtctacccttggcaaaat
gtcactattgttggcacaactgatgtagagcatttatcgccactatctgaagaagcgagt
atcagtcaggcagagtttgactatttacttaaggctgtcgctcagcagtttcccgatgcc
aatattaacgccagcgatgttatttcaaccttttccggtgttcgccctgtaaccacctca
gctaaaaatgcacctccgtcaaaagaaaaacgtcagcatcagataaataatcatgacggc
gttattagtgtcaccggcggtaagttaacaacgtttcgtttaattgcagagcaagtgtta
caacaagccgctcagtatattgctgtagctgattttcaccataagctgcaagcggttaat
caatatgccattttctcaccggctaattgtcagtctgagcggttgctgccagcacaggtt
gaacagcatattttggcttgttatggctcacttagtcagcattttatcaagctttcagat
gctcagcagttattgccgatacgctatagtaagcacgtctgggcggagcttatttgggcg
gtacaatacgagcaagtgcaacaccttgatgatctattattaagaagaacacgccttggt
aatgtattgccaaaaggaggcatagatttactgccaaaaatacaagccttatgcgcacct
tatatgccatggagtgacactgattggcagcaggaaattgctcgttatatgcaattgtgg
cgaaaatattatcgcgtacctgagtgcggtgacagcaaataa

DBGET integrated database retrieval system