KEGG   Litorilituus sediminis: EMK97_10770Help
Entry
EMK97_10770       CDS       T05852                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00260  Glycine, serine and threonine metabolism
lsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EMK97_10770
Enzymes [BR:lsd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     EMK97_10770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 Pyr_redox HI0933_like Pyr_redox_3 Pyr_redox_2 FAD_oxidored Methyltransf_25 FAD_binding_2 2-Hacid_dh_C MTS
Motif
Other DBs
NCBI-ProteinID: QBG36160
LinkDB All DBs
Position
complement(2412067..2413095)
Genome map
AA seq 342 aa AA seqDB search
MKSLVKLKPEPGIWLQRTEKPKVGHNDLLIKINKTAICGTDIHIYNWDEWSQKTIPVPMV
VGHEYAGEVVGIGQEVKGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGS
FAEYLVIPAYNAFKLPDEISDDLAAIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVAKHVGARHVVITDVNEYRLDLARKMGATRAVDVSKENLADVMSELGMTEGFDVGLEMS
GVPAAFTSMLENMNNGGKIAMLGIPGSDMAIDWSQVIFKGLTIKGIYGREMFETWYKMAS
LIQSGLDLTPIITHHYSIDDFQEGFDVMRSGQSGKVILDWTK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattagttaaattaaagccagagccgggaatttggttacagcgcacggaaaag
ccaaaagtaggtcacaatgacttactgataaaaattaataaaactgctatttgtggtacc
gatattcatatttataactgggatgagtggtcacaaaagacgattcctgtgcctatggtg
gttggtcatgaatatgccggtgaagtggttggcattggccaagaagtaaaaggctttgag
attggcgatcgcgtatcgggtgaaggtcatattacttgtggtcattgtcgtaactgtcgt
ggtggcagaacgcacttgtgtcgcaataccgtaggtgttggggttaatcgccccggctct
ttcgctgaatacttagtgattccagcttacaatgcctttaaattacctgatgaaatctct
gatgatttagcagctatttttgacccgtttggtaatgcagtacatacggcattatcattc
gatttagtcggtgaagatgtacttattacgggtgctggtcctattggtattatggcggct
gcggttgctaaacacgttggcgcccgccatgtagtgattactgatgtcaatgaatatcgc
cttgatttagcaagaaaaatgggcgcgacacgtgcagttgatgtcagtaaggaaaactta
gctgatgtcatgtctgagctggggatgacagaaggttttgatgttggcctagaaatgtca
ggcgtaccggcggcctttactagcatgctagagaatatgaataatggcggaaaaatcgct
atgttaggtattcctggtagcgatatggccattgattggagccaagtaattttcaaagga
ttaacgattaagggaatttatggtcgcgaaatgtttgaaacttggtataaaatggcgagc
ttaattcaatcaggtttggatttaacaccaattattactcatcattactccattgatgat
ttccaagagggctttgatgtaatgcgctctggtcaatcgggtaaggtgattttagattgg
actaaatag

DBGET integrated database retrieval system