KEGG   Litorilituus sediminis: EMK97_14125Help
Entry
EMK97_14125       CDS       T05852                                 

Definition
(GenBank) peptidoglycan glycosyltransferase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00550  Peptidoglycan biosynthesis
lsd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EMK97_14125
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EMK97_14125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lsd01011]
    EMK97_14125
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lsd03036]
    EMK97_14125
Enzymes [BR:lsd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EMK97_14125
Peptidoglycan biosynthesis and degradation proteins [BR:lsd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   EMK97_14125
Chromosome and associated proteins [BR:lsd03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    EMK97_14125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: QBG36777
LinkDB All DBs
Position
3169881..3171629
Genome map
AA seq 582 aa AA seqDB search
MSKKTATNRSNKTSQPSTAAWRYYLVLVVVALIYLGLMARSAYIQVIEPEMLKKQGDMRS
LRVHADSVQRGSIVDRNGAELAISVPVETVWADPKIIMDNNALAMTEHWQALADVLDQDI
SELTTRIVKNSRKRFVYLERKISPAMANYIKELKIPGIHLRKESKRFYPAGEISAHLVGF
TNVDDKGIEGIERLYDQLLTGKGGAKRFRKDAKGRKIEILSVEEAEHAQDITLSIDQRIQ
AIAYKELKGAVQAFKAASGSVVVANAHTGEILAMTNSPSYNPNNRRNTALHRFRNRAITD
IYEPGSTMKPLTALTALEFGSAEADTVINTSPGWMRLGGRRVSDPINRGELSIEEILIHS
SNMGTTKLALSVPKNYLLDKFFDVGFAEDTGTELVGESTGMMHDRQRWSQFELATLSWGY
GLAITPLQLARFYSALANGGVKRELSIVKTDKPSEGERIFSKENSLAIVNMLEAVVDDHV
PRAKVEGYRVGGKTGTSFKAVPGGYGNDYVGLFAGIAPISNPEIVVVVVINDPGGDLYHG
GEVAAPVFSRVMKGALRVLNIAPDASNMAVQTPKSHNGGHDA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagaaaactgctacaaatcgaagtaacaaaacaagtcaaccaagtaccgctgcc
tggcgttattacttggtgcttgtggttgtggctttgatctatcttggccttatggctcgc
tctgcatatattcaggttattgagcctgaaatgttgaaaaagcaaggggatatgcgctca
cttcgtgttcatgcagatagtgtgcagcgcggctcaattgttgatcgcaatggtgcggag
cttgctatcagtgtccctgtagaaacggtatgggctgatcctaagattattatggataac
aatgctctagcaatgacggagcactggcaagccttggcagatgtactcgatcaagatata
agtgagttaactactcgtatcgtaaaaaattcaagaaagcgctttgtttacttagagcga
aaaatatcgccagcaatggctaattacataaaagaattgaagataccaggtattcattta
cgtaaagagtctaaacgcttttatccggccggtgaaatcagcgcacatttagttggtttt
actaatgttgacgataaaggtattgaaggtatcgagcgtttgtatgatcagttactcaca
ggtaaaggtggtgcaaaacgctttagaaaagatgccaagggcagaaaaattgagatctta
tcggtagaagaagcagagcacgctcaagatatcactttaagcatagatcaacgtattcaa
gccatagcctacaaagagcttaaaggggctgtgcaggcgtttaaagcagcatcaggctca
gtggttgttgctaatgctcataccggcgagatattggcgatgaccaatagcccatcatat
aacccaaataatagacgtaatactgcactacatagatttagaaaccgagcaattactgat
atttatgagcccggctcaaccatgaaaccgttaacggcattaacagcgctagagtttggt
tcagctgaggctgataccgtaattaatactagcccaggctggatgcgtttaggcggcaga
agggtcagtgatccaattaaccgtggtgaattatcgattgaagaaatcttgattcattca
tctaatatgggcactaccaaattggcattatctgtaccgaaaaattacttgctagataag
ttcttcgatgttggttttgccgaagataccggcacggagttggttggtgaaagtactggc
atgatgcatgaccgccagcgttggtcgcaatttgaattggcgacactatcttggggttat
ggtttagcgatcaccccgttgcaattagcgcgtttttattctgcgttagctaatggtggt
gttaaacgtgaattatctattgtcaaaacagacaagccttcagaaggtgagcgcattttt
tctaaagaaaatagcttagctattgtcaacatgctagaagcagtagttgacgaccatgta
cctagagccaaagttgaaggttatcgagttggtggtaaaacgggcacctcatttaaagcg
gtgcctggtggttatggtaacgactatgttggcctgtttgctggtattgcaccaatttcc
aaccctgaaatagtggttgtcgttgtcattaatgatcccggtggtgatttgtaccacggc
ggcgaagtggcagcgccggtattttctagagtgatgaaaggtgctcttagggtgctaaat
attgccccagatgcaagcaatatggcagtgcaaactccaaaaagtcataacggaggccat
gatgcataa

DBGET integrated database retrieval system