KEGG   Litorilituus sediminis: EMK97_14165Help
Entry
EMK97_14165       CDS       T05852                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00473  D-Alanine metabolism
lsd00550  Peptidoglycan biosynthesis
lsd01100  Metabolic pathways
lsd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EMK97_14165
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EMK97_14165
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EMK97_14165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lsd01011]
    EMK97_14165
Enzymes [BR:lsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EMK97_14165
Peptidoglycan biosynthesis and degradation proteins [BR:lsd01011]
 Precursor biosynthesis
  Amino acid ligase
   EMK97_14165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: QBG36783
UniProt: A0A4P6P5L7
LinkDB All DBs
Position
3180982..3181941
Genome map
AA seq 319 aa AA seqDB search
MFSQDKIAQLKQEKIAVLYGGTSAEREVSLNSGKAIAKGLIESGYNAELFDTKAVSLTEL
TQQGIDRVFIALHGRGGEDGCLQGALEYMGLPYTGSNVLGSALSMDKVRSKQIFVANELP
TAAFKVVDKTSFEERVDDATLLTELLSSLGGRVMVKPANEGSSIGMAQAQTAEQLGNALT
EAFGFDEQVLLEAWIDGPEYTVSILGDEALPAIHMETPREFYDYEAKYQSNSTQYHCPCG
LDEKDELAIQGLALKAFRATGAKGWGRVDLMRQPSGEWQLLEVNTVPGMTETSLVPKAAK
QYGLSFKALVERILLLSAI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtcaagataaaattgcccagttaaaacaagaaaaaattgccgttttatacggc
ggtacctcggcagagcgagaggtgtctttaaattcaggtaaggcgattgcgaaaggctta
atcgagtcaggctataacgctgaattgtttgataccaaggctgtttcgttaactgaactt
actcaacaaggtattgatagggtatttatcgccttacatggtcgtggtggtgaagatggt
tgtttgcaaggcgcgcttgagtatatgggcttgccttataccggctctaatgtgcttggt
tcggctttatctatggataaggtgcgtagtaaacagatttttgttgccaatgagttacct
accgctgcctttaaagttgtagataaaactagttttgaagagcgagtagatgatgccacg
ttattaaccgagctgctgtcttcattaggtggccgagttatggttaaacctgccaatgaa
ggttctagcattggcatggcgcaggcacaaaccgcagagcaattaggtaatgctttaaca
gaggcatttggttttgatgagcaagtgctattagaagcttggattgatggccctgaatat
acggtaagtattttaggtgatgaggctttacccgcgattcatatggaaacgccacgtgag
ttttatgattatgaagctaaatatcaatcaaattcaacgcaatatcattgcccatgtggc
ttagatgaaaaagatgaattagcgattcaaggcttggcattaaaagcatttagagctacg
ggtgctaaaggttggggacgtgtagatttaatgcgtcaaccaagtggcgaatggcagtta
ttagaagttaatactgtgccaggtatgacggaaacatcattagtgcctaaagcagcaaaa
caatatgggcttagctttaaagccttggttgagcgcattttattattaagtgctatttag

DBGET integrated database retrieval system