KEGG   Litorilituus sediminis: EMK97_18135Help
Entry
EMK97_18135       CDS       T05852                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lsd  Litorilituus sediminis
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EMK97_18135 (ahpF)
Enzymes [BR:lsd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EMK97_18135 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA DAO HI0933_like Thi4 FAD_binding_3 AlaDh_PNT_C Glutaredoxin FAD_oxidored Lycopene_cycl NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: QBG37518
UniProt: A0A4P6P8Q1
LinkDB All DBs
Position
complement(4089248..4090831)
Genome map
AA seq 527 aa AA seqDB search
MLDTNLKNQLNAYLQNLNSAVELAVFLDEGVKSKELQALAQEIATMSPLITMVEKQDINE
RTPSMLVRSVANNTEIRFAGVPMGHEFTSLVMALLHSGGHPIKLDEEIIEQVRQLEGEFS
FETYVSLSCQNCPDVVQALNMMAAINPKITNVMIDGSVFSEEVYQKDVLSVPAVYLNGQE
FSQGRMTITEILKKVDTNADARQAKKINEKETFDLLVIGGGPAGASSAIYSARKGIKTGV
VADRFGGQVQDTMAIENFISVKATEGPKLVQSLEAHVNDYDVDVMNGQRVKNIIEAEVNG
GLITVELENGASLQTRSAILATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKSVAV
IGGGNSGIEAAIDLAGIVEHVTVLEFDSKLRADAVLQDKARSMDNISIIVNAQTTEVLGN
GKHVTGLNYLCRESQQTKQLALAGIFVQIGLVPNTQFLQGTVALNQRGEIITTSSGETNI
PGVYAAGDATDSPYKQIIIAMGSGASAALGAFDYLIRTPEVSNTKVA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaacttaaaaaatcaattaaacgcttatttacagaatttaaactctgcg
gttgaattagcagtgtttctagatgaaggcgtaaaatcaaaagaactacaagcattagcg
caagaaattgccaccatgtcaccattaatcactatggtagaaaaacaagatattaatgaa
cgtactccgtctatgttagtgcgctcagttgcaaacaacactgaaattcgctttgctggt
gtacctatgggtcatgaatttacttcgcttgttatggcactgctacacagcgggggccac
ccaattaaattagatgaagaaatcattgagcaagtaagacagcttgaaggcgaatttagc
tttgaaacttacgtatcacttagctgtcagaactgccctgatgtggtacaagccttgaat
atgatggcagcaatcaacccaaaaataaccaatgtaatgattgatggttcggtcttttcc
gaggaagtctatcaaaaagatgtcttatctgtgccagccgtttacttaaatggtcaagaa
tttagccaagggcgcatgacgattaccgagattttaaagaaagttgatactaatgctgat
gcccgtcaagcgaagaaaataaatgaaaaagaaacctttgatttattagtaattggcggc
ggccctgctggtgcttcttcagccatatacagtgctcgcaaaggcataaaaaccggcgtg
gttgctgataggtttggcggtcaagtacaagatactatggcgattgaaaactttatctca
gttaaagcgactgaaggccctaaattagtgcaaagtttagaagcacacgttaatgattat
gatgttgatgtgatgaatggtcagcgcgtaaaaaacattattgaagctgaggttaatggt
ggcttgatcacagtagagctagaaaacggcgcaagtttacaaacccgttcagccatatta
gcaacaggcgcaagatggcgtgaaatgaatgtgccaggcgagcaagaataccgtggtaaa
ggcgtggcctactgtccgcactgtgatggccctttatttaaaggcaaatcagtcgctgtt
attggtggtggcaattcaggcatagaagccgcaattgatttagcgggtattgtagaacat
gtcactgtactagagtttgatagcaagctaagagctgatgccgtattacaagacaaagca
cgttcaatggacaacatctctattatagtgaacgcacaaaccactgaagttctagggaat
ggcaaacacgttaccggcttaaactacttatgccgtgaaagccaacaaacaaaacagcta
gcgctagcaggtatatttgtacaaattggcttagtaccgaatacccagtttttacaaggt
acggtagcactaaaccagcgtggtgaaattattaccacaagttcaggtgaaaccaatata
cctggagtttacgctgctggtgatgcaactgacagcccatataaacaaattattattgct
atgggcagtggcgctagcgctgccttaggtgcctttgattatttaatcagaacgcctgaa
gttagtaatacaaaagtcgcttag

DBGET integrated database retrieval system