KEGG   Listeria seeligeri: lse_0825Help
Entry
lse_0825          CDS       T01184                                 

Definition
(GenBank) sulfatase family protein
  KO
K19005  lipoteichoic acid synthase [EC:2.7.8.20]
Organism
lsg  Listeria seeligeri
Pathway
lsg00561  Glycerolipid metabolism
lsg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    lse_0825
Enzymes [BR:lsg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.20  phosphatidylglycerol---membrane-oligosaccharide glycerophosphotransferase
     lse_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase DUF4126 DUF229 Phosphodiest
Motif
Other DBs
NCBI-ProteinID: CBH26976
LinkDB All DBs
Position
complement(877819..879783)
Genome map
AA seq 654 aa AA seqDB search
MKDWKIKIQTFLSKNYGFFVLAVILYWLKTYIAYQIEFKLGIENLMQQILLFINPLSGTI
FFLGLALFAKGRRSFIWIIVIDFLMTFILYANIVYYRFFSDFITLPNLNPKQMQNMGDMG
SSITALLSWHDVIYFVDIVLLIALLVFRFVKPDKTARIRARKVVGVLTLGIAMFFANLGL
AEIDRPQLLTRTFDRNYIVKYLGMTNYQIYDAVKSTESSTQRALADSSDVTEVLNYTKSK
YAAPNPEYYGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDKNTLSFTNFFH
QTGQGKTADSEMLLENSLYGLAEGSAFTTKGQNTYESASAILGQQGYTSSVFHGNYKSFW
NRDEIYKQFGYDHFYDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLPQPFYTKFITLT
NHFPYPIDEKDATIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYG
DHYGISDNHEEAMTKILGKEYNTFENAQAQRVPLMIHVPGVEGGVQEQYGGQVDLLPTLL
HLLGIDNKEYLQFGTDLLSEDHKQLVPFRNGDYITPDYSMIGGNMYNQKTGEPIATETKE
MKDTKEKVAKELELSDSVLQGDLLRFYAPEGFEKVDPSKYNYNKKKPTDSKEDK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattggaaaataaaaatccaaacgtttttaagcaagaattatggattttttgtt
ctagccgtcattctttattggctaaaaacgtatattgcatatcaaattgaatttaaacta
ggtattgaaaatctaatgcaacaaatattgctgttcattaatccattaagtggaactatt
tttttcttaggtcttgcactttttgctaaaggccgtcgttcatttatctggattatcgtc
attgatttcttaatgacatttattctttacgcaaatattgtgtattacagattctttagt
gattttattacacttccgaatctaaatccaaaacaaatgcaaaacatgggcgacatgggt
agcagtatcacagctttacttagctggcatgatgttatttattttgtggacattgtgcta
ttaattgcacttcttgttttccgctttgtaaaacctgacaaaactgctcgtattcgcgca
agaaaagttgtcggcgtattaacgcttggtatcgcaatgttctttgcaaacttaggactt
gcagaaatcgatcgtccgcaattattaacaagaacttttgatagaaactatatagtaaaa
tatcttggtatgacgaactaccaaatttatgacgcagtgaaaagtacggaatcttccact
cagcgtgcacttgctgatagtagtgatgtaacagaagtactaaattacaccaaatcaaaa
tatgccgcgccaaatccagagtactacggtaaagcgaaaggcaaaaacgttatttatatt
catttagaaagtttccaacaattcttagtgaattataaattaaatggtgaagaagtaacg
ccgtttattaactctttctttaaagataaaaatacactaagctttacaaactttttccac
caaacaggacaaggtaaaacagccgattctgagatgttacttgagaattcactttatggg
ttagctgaaggttctgcttttacaactaaaggacaaaacacctatgaatcagcatctgct
attttaggtcaacaaggctatacaagttctgttttccacggtaactataagagtttctgg
aaccgtgatgagatttacaaacaatttggttatgatcatttctatgatgctagttattat
gatatgaacgaagcagatgtttccaattacggattaaaagataaaccattctttaaagag
tcagaagaatatctatcttccctaccacaaccattctatacgaaattcattacgttaact
aaccacttcccttatccaattgatgagaaggatgcaacgattgccccagcaacaacgggt
gattcttcggttgatacgtatttccaaaccgctcgttacttggatgaatctgtgaaaagc
ttcgtggattacttgaagaaatcgggactttacgataattctgtaatcattatgtacgga
gatcactatggtatttctgataaccatgaagaagccatgacgaaaatccttggcaaagag
tacaacacttttgagaatgcccaagcgcaacgtgtgcctttaatgattcatgttcctggt
gtagaaggtggcgtgcaagaacaatatggtggtcaagttgaccttttaccaacgttactt
cacttactaggtattgataacaaagagtacttgcaatttggtacagatttactttcagaa
gatcataaacaattagttcctttccgaaacggtgattatattaccccagattattctatg
attggcggcaatatgtacaaccaaaaaacgggcgaaccaattgcgaccgaaacaaaagaa
atgaaagacacaaaagaaaaagtagccaaagaactagagctttctgattctgtcttacaa
ggtgatttgttacgattctatgcccctgaaggttttgaaaaagtggatccaagtaaatat
aactacaataagaaaaaaccaactgattcaaaagaagataaataa

DBGET integrated database retrieval system