KEGG   Listeria seeligeri: lse_1358Help
Entry
lse_1358          CDS       T01184                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lsg  Listeria seeligeri
Brite
Enzymes [BR:lsg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     lse_1358 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CBH27509
LinkDB All DBs
Position
complement(1389208..1389816)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHADLASKPVEELVAN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKTAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWEEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattaccaaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaacaatggaaattcactatacaaagcaccacaatacttatgtaacaaaactaaat
gaagcagttgctggacacgcagatcttgcaagcaagcctgtagaagaattagttgctaat
ctagatagcgttcctgaagacattcgcggtgcagtacgtaaccatggtggtgggcatgct
aaccatacattattctggtctatccttagtccaaatggcggcggggcaccaactggtaac
ttgaaaacagcaatcgaaagtgaattcggtacttttgacgaatttaaagaaaaatttaac
gcagcagctgcagcacgttttggctctggttgggcatggctagtagttaataacggtaaa
ttagaaatcgtttctactgcaaatcaagattctccacttagcgaaggtaaaacaccagtt
cttggcttagacgtttgggaacatgcttattaccttaaattccaaaatcgtcgtcctgaa
tacattgacacattttggaatgttatcaactgggaagaagcaaacaaacgctttgacgca
gcaaaataa

DBGET integrated database retrieval system