KEGG   Listeria seeligeri: lse_1420Help
Entry
lse_1420          CDS       T01184                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
lsg  Listeria seeligeri
Brite
KEGG Orthology (KO) [BR:lsg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lsg02000]
    lse_1420
Transporters [BR:lsg02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter
    lse_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_22 SbcCD_C AAA_29 AAA_30
Motif
Other DBs
NCBI-ProteinID: CBH27571
LinkDB All DBs
Position
complement(1448039..1448734)
Genome map
AA seq 231 aa AA seqDB search
MTKILTFENIHYWYKTKDESILSDINYDFESGIFYTVVGSSGSGKTTFLSLAGGLDTQKE
GDIYYKGSSLKSIGLQKFRNQYVSIVFQSYNLLTYMTALQNVTTAMEITHVNQPDKKTFA
LKMLEKVGITEKMARQKVLTLSGGQQQRVSIARALCCETELIVADEPTGNLDERTSKEVV
TLFQDLAHKEGKCVIMVTHDPEIANVSDVKLTLKNGSFVEKKQSVSSLIKS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatattaacctttgaaaatatccattattggtacaaaacaaaagacgaatcg
attttaagtgatataaattatgattttgaatcaggtatcttttacactgtcgtcggaagt
tcaggatcaggtaaaacaacctttttatcgttagcaggtgggctagatacacaaaaagaa
ggtgacatttattataaaggtagttctttaaaaagcattggcttacaaaaattcagaaat
caatatgtatcaattgttttccaaagctataatttattaacctatatgactgcacttcaa
aatgttacaaccgccatggaaattacacatgtgaaccaaccagataaaaaaacttttgca
cttaaaatgctagaaaaagtaggaatcaccgaaaaaatggctcgccaaaaagtactgact
ttaagtggtgggcaacaacaacgggtttcgattgcacgagccttatgttgtgaaacggaa
ctaatcgtagcagatgaaccaactggaaacctcgatgaacggacaagtaaagaagtggtt
accttgttccaagatttagcgcataaagaaggaaagtgtgtcattatggtaacccacgat
ccagaaatcgccaatgtatctgatgtcaaactaactctgaaaaatggcagctttgtcgaa
aagaaacaatctgttagtagtttaataaaaagttga

DBGET integrated database retrieval system