KEGG   Listeria seeligeri: lse_1438Help
Entry
lse_1438          CDS       T01184                                 

Gene name
relA
Definition
(GenBank) GTP pyrophosphokinase
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
lsg  Listeria seeligeri
Pathway
lsg00230  Purine metabolism
lsg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    lse_1438 (relA)
Enzymes [BR:lsg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     lse_1438 (relA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT ACT_4 TGS HD ACT YfcL NapD DUF493
Motif
Other DBs
NCBI-ProteinID: CBH27589
LinkDB All DBs
Position
complement(1468753..1470969)
Genome map
AA seq 738 aa AA seqDB search
MAKEQNLTAEQVIDMASHYMNQEHLALVKKAYEFARDSHKEQFRKSGEPYIIHPIQVAGI
LVELKMDPSTVASGFLHDVVEDTPVTLADLEEEFGSEVAMLVDGVTKLGKIKYKSHEEQQ
AENHRKMFIAMAQDIRVILIKLADRLHNMRTLKHLPVEKQRRIANETLEIFAPLAHRLGI
SRVKWELEDTALRYLNPQQYYRIVHLMKQKRDARERYLHDVIDGVNENLDELNIQADISG
RPKHIYSIYRKMSEQNKQFNEIYDLLAVRIVVSSIKDCYAVLGIIHTRWKPMPGRFKDYI
AMPKSNMYQSIHTTVIGPQGEPLEVQIRTHEMHQIAEYGVAAHWAYKEGKVVNSKTSFDN
KLTWFREILEYQNESDNAEEFMESLKLDLFSDVVYVFTPKGDVYELPNGSVPLDFAYRVH
TEIGNKTIGAKINGKIVTLDYKLKTGDIIDILTSKHSYGPSRDWLKLVQTSQARNKIKQF
FKRQAKEENVEKGRDLVEKEIRQLGFEPKKIMLPENLRKLADKLNFSHEDDLFAAVGYNG
ITALQVANRLTEKLRKERELEAETEKLLTQAENKPSNSDANNEKLKIKHNAGVVVQGVGN
LLIRLSRCCNPVPGDEIVGYITKGRGISIHRQDCPNVQAIEAERLIEVDWEDADSQAKND
YNVDIEIYGYNRNGLLNDILQVINSLTSNINGVNAKVDNNKMATLVVTLQIHNINHLQRV
VDKIKQIPDVYTVRRLMN
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaacaaaatctgacagctgagcaagttatcgatatggcttctcattatatg
aatcaggaacatcttgcgcttgtaaaaaaagcgtatgaatttgcgcgcgattctcataaa
gaacagtttcgtaaatcaggtgagccgtatattattcatccaattcaagttgctggcatt
ttagtagaattaaaaatggatccttcgacagttgcatcaggttttttgcatgatgtcgta
gaggataccccggttacactggcagatttagaagaagaatttggcagtgaagttgctatg
cttgtagatggggttaccaaacttggtaaaattaaatataaatcacatgaagaacaacaa
gcggagaatcacaggaaaatgtttattgccatggcgcaagatatccgtgttattcttatt
aaacttgccgaccgtttgcataatatgcgcacattaaaacatctaccagttgaaaagcaa
cgtcgaattgctaatgaaacgttagaaatttttgcaccgcttgcgcacagactaggaata
tcccgtgtgaaatgggagttagaagatacggcgttacggtatttaaacccacaacaatat
taccgaatcgttcacttgatgaagcaaaagcgtgatgcaagagagcgttatttacatgat
gtgattgatggcgttaatgaaaacttggatgaacttaatattcaagccgacatttctgga
agaccaaaacatatctattccatttaccgaaagatgagcgaacaaaacaaacaatttaac
gaaatttatgatttgcttgcggtccgaattgtagttagcagcatcaaagattgttatgct
gtccttggaatcatccacacgcgctggaaaccgatgccaggtcgctttaaagactatatt
gctatgcctaagtcgaatatgtatcaatccatccatacgaccgttatcggacctcaaggc
gagccgctcgaagttcaaatccgtacacatgaaatgcatcaaattgcagaatacggggtt
gcggcacattgggcgtacaaagaaggtaaagttgtcaattcaaaaacctcttttgataat
aaattaacttggttccgagaaattttagaatatcaaaatgaatcggataatgccgaggag
ttcatggaaagcttaaaactcgatttattttcagatgtggtctatgtcttcacaccaaaa
ggggacgtctacgaacttccaaatggttccgtaccgcttgattttgcctaccgtgtgcat
acagaaatcgggaataaaacaattggtgcgaaaattaacggaaaaattgtcaccttagat
tataagttgaaaacaggcgatattattgacattttgacgtcaaaacattcctatggaccg
agccgcgactggttgaaactcgttcaaacttctcaagctagaaacaaaatcaagcaattc
tttaaacgacaagcaaaagaagaaaacgtcgaaaaaggccgcgatttagtcgaaaaagaa
attagacagcttggatttgaaccgaagaaaattatgttaccagaaaatctacgtaagtta
gccgacaaattaaacttttcgcatgaagatgatctttttgctgcagttggctataacggt
attacggccttgcaagtggccaatcgtttaaccgaaaaacttcgaaaagaacgtgaatta
gaagcggaaacggaaaaattacttacgcaagctgaaaacaaaccatctaattcagatgct
aacaatgaaaaactaaaaattaaacacaatgctggagtggttgttcaaggtgtagggaac
ttactcattcgcctttctagatgttgtaatccagtgcctggggatgaaatcgttggttat
attaccaaaggacgaggaatctccattcaccgtcaagattgcccaaatgttcaagcaatc
gaagcagagcgcttaattgaagtagactgggaagacgcagattcgcaagcaaaaaatgat
tataacgtggatatcgaaatctatggttataatcgtaatggcttactaaatgatattttg
caagtcatcaatagtttgacttcaaatatcaatggtgtgaatgctaaagtagacaataat
aaaatggcaacgcttgttgtcacgcttcaaattcataatattaatcatttacaacgagtg
gtagataaaatcaaacaaattcctgatgtatatacagtgagacgattaatgaattaa

DBGET integrated database retrieval system