KEGG   Listeria seeligeri: lse_2490Help
Entry
lse_2490          CDS       T01184                                 

Gene name
lmrB
Definition
(GenBank) lincomycin resistance protein
Organism
lsg  Listeria seeligeri
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: CBH28641
LinkDB All DBs
Position
complement(2564507..2565988)
Genome map
AA seq 493 aa AA seqDB search
MNSTAVERPVDVNGKSYSRSLLVVTMIIGAFVAILNQTLLATALPMIMDDLHITAATGQW
LTTAFLLTNGIMIPITALLIEKISSKTLFITAMSVFTVGTIIASMSGSFPMLLTGRIVQA
AGAGIMMPLLQTIFLLIFPREKRGAAMGLMGLVIAFAPAIGPTLSGWIVDSYDWRVLFII
LIPIAIIDIILAFFGMKKVVKLTDTKIDFLSIVMSSIGFGALLYGFSSAGNDGWGDATVI
TMLIIGVVVIALFVWRQLVIDNPMLELHVFKYPVFSLSVILGSIVTMAMIGAEIVLPLYI
QTIRGESALQSGLLLLPGAIIMGIMSPITGIIFDKIGAKWLTITGVTILTIGTIPFMFLT
MDTPLWYIVVFYAVRFFGISMAMMPVSTAGMNALPNHLINHGSAVNNTIRQIAGSIGTAV
LITVLTNVTKDNMPSKMLAGTDPAAFAQQAQDASLDGMRAAFMVAAIFAAIGMFLSFFLK
TKKQEPIVKEYTK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtacagcagtagaacgtcctgttgatgttaacgggaaatcgtacagtagaagt
ttattagtagtaacaatgattattggggcatttgtagcgatattgaatcagacgctctta
gcaaccgcgctaccaatgattatggatgatttgcacattacagcagcgacagggcaatgg
ttgacaacggctttcttgctgacaaatgggattatgattccaatcacagcacttttaatt
gaaaaaattagttctaaaacattatttattacagcaatgtctgtatttacagtagggaca
attatagcgtccatgtcgggttcattcccaatgttattaacaggtcggattgttcaagca
gccggagcggggattatgatgccgctcttgcaaactatcttcttactgatttttccgcgt
gaaaaacgtggtgcagcgatggggcttatgggattagttattgccttcgctccagcaatt
gggccaactttatctggttggattgttgattcctatgactggagagttttatttattatt
ttaatcccaattgcgattattgatattattttagcctttttcggaatgaaaaaagtagtt
aaattaactgatacaaaaattgattttctttcaattgttatgtcatcaatcggttttggc
gcacttctttatggatttagttcagcggggaatgatggctggggagatgcgactgttata
acaatgctgattattggggttgttgtgattgcgctctttgtttggcgtcaactagtgatt
gataacccaatgcttgaattacacgtgtttaaatatcctgtattctcgctttctgttatc
ctaggttcaattgtcacaatggcaatgattggtgcagaaatcgtactacctctttatatt
caaactatccgcggggaatcggcactgcaatcaggattactattactgccgggtgcgata
attatgggtataatgagtccgataacaggaattatatttgataaaattggtgcgaaatgg
ctgacgattaccggggtgaccattttaactattggtacaataccatttatgttcttgaca
atggatacaccactttggtatattgtggtattttatgcggttcgattcttcgggatttcg
atggcgatgatgccggtttcaactgctggaatgaatgccttgcctaatcacttgattaat
cacgggtcggcagttaataatacaattagacaaattgctggttcaattggtacggctgtc
ttgattacagttttgacgaatgtaacgaaagataatatgccaagtaaaatgttagcggga
acggatccggcagcatttgcacaacaagcacaagatgctagcttagatggcatgcgcgcg
gcctttatggttgctgcaatctttgctgctattgggatgttcttgagtttcttccttaaa
actaagaaacaagaaccaattgtaaaagaatatacgaaataa

DBGET integrated database retrieval system